DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Yp3 and CG10116

DIOPT Version :9

Sequence 1:NP_001285228.1 Gene:Yp3 / 32339 FlyBaseID:FBgn0004047 Length:420 Species:Drosophila melanogaster
Sequence 2:NP_648652.1 Gene:CG10116 / 39515 FlyBaseID:FBgn0036367 Length:289 Species:Drosophila melanogaster


Alignment Length:284 Identity:75/284 - (26%)
Similarity:117/284 - (41%) Gaps:63/284 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   153 NLQQLQKNAQ----EQQQQLKSSDYDYTSSEEAADQW------------KSAKAASGDLIIIDLG 201
            |.:::|:|||    |.:..::||.|....:.....:|            .||:....|..||.:.
  Fly    27 NTRRVQENAQPIEAEVEALVRSSFYAADPTVVTIPRWLGNISSPEIPAVVSARLQQQDSNIISVD 91

  Fly   202 STLTNFKRYAMLDVLNTGAMIGQTLIDLTNK-GVPQEIIHLIGQGISAHVAGAAGNKYTAQTGHK 265
            .:..|.:    .:::::   :...:|.|.|: .:|.:.|.::|....||:||....|.....|.:
  Fly    92 LSEANDE----TEIIDS---VASLVIVLHNQFDMPLDRILVVGFAEGAHLAGGVAAKVQQDLGRQ 149

  Fly   266 LRRITGLDPAKVLSKRPQILGGLSRGDADFVDAIHTSTFAMGTPIRCGDVDFYPNGPSTGVPGSE 330
            |.:||.|||    |...::...||:.||:||:.:||:....||..|.|.||:||||..| .||..
  Fly   150 LSQITALDP----SSGAELDHKLSQADAEFVEVVHTNAGGEGTWERLGHVDYYPNGGQT-QPGCT 209

  Fly   331 NVIEAVARATRYFAESVRPGSERNFPAVPANSL-----------------KQYKEQDGFGKRAYM 378
            ....:..||....||...|  |.:|.:....|:                 ||.:||..       
  Fly   210 TDSCSHERAFELLAEMWSP--ENDFVSARCGSVETLSASSCRWSTHKMGQKQEEEQPA------- 265

  Fly   379 GLQIDYDLRGDYILEVNAKSPFGQ 402
                    .|.|.||....|||.:
  Fly   266 --------SGIYFLETRQSSPFSR 281

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Yp3NP_001285228.1 Lipase 93..400 CDD:278576 73/280 (26%)
Abhydrolase <215..396 CDD:304388 56/198 (28%)
CG10116NP_648652.1 Abhydrolase 24..274 CDD:304388 72/275 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45438320
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_28N19
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11610
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.