DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Yp3 and lipca

DIOPT Version :9

Sequence 1:NP_001285228.1 Gene:Yp3 / 32339 FlyBaseID:FBgn0004047 Length:420 Species:Drosophila melanogaster
Sequence 2:NP_957316.1 Gene:lipca / 393997 ZFINID:ZDB-GENE-040426-1361 Length:514 Species:Danio rerio


Alignment Length:199 Identity:60/199 - (30%)
Similarity:92/199 - (46%) Gaps:37/199 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   183 DQW-----KSAKAASGDLIIIDLGSTLTNFKRYAMLDVLNTGAMIGQTLIDLTN-----KGVPQE 237
            ::|     .:.|::.|::.:: :...||...::..:...|| .::||.:..|.:     |..|..
Zfish    94 EKWISRLASALKSSEGNINVL-IADWLTLAHQHYPIAAQNT-RIVGQDIAHLLSWLEDFKQFPLG 156

  Fly   238 IIHLIGQGISAHVAGAAGNKYTAQTGHKLRRITGLDPAKVLSKRPQILGGLSRGDADFVDAIHTS 302
            .:||||..:.||::|.||:. .|.:|..|.||||||||..:.:.......||..||.|||||||.
Zfish   157 KVHLIGYSLGAHISGFAGSN-LAMSGRTLGRITGLDPAGPMFEGMSHTDRLSPEDAKFVDAIHTF 220

  Fly   303 T-----FAMGTPIRCGDVDFYPNGPS------------------TGVPGSENVIE-AVARATRYF 343
            |     .::|........||||||.|                  .|:.|.|..:: |..||...|
Zfish   221 TLQRMGLSVGIKQPVAHFDFYPNGGSFQPGCQLHMQNIYAHLAQHGIMGFEQTVKCAHERAVHLF 285

  Fly   344 AESV 347
            .:|:
Zfish   286 IDSL 289

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Yp3NP_001285228.1 Lipase 93..400 CDD:278576 60/199 (30%)
Abhydrolase <215..396 CDD:304388 55/162 (34%)
lipcaNP_957316.1 lipo_lipase 44..488 CDD:132274 60/199 (30%)
Pancreat_lipase_like 54..344 CDD:238363 60/199 (30%)
PLAT_LPL 351..485 CDD:238856
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_28N19
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11610
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.