Sequence 1: | NP_001285228.1 | Gene: | Yp3 / 32339 | FlyBaseID: | FBgn0004047 | Length: | 420 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_957316.1 | Gene: | lipca / 393997 | ZFINID: | ZDB-GENE-040426-1361 | Length: | 514 | Species: | Danio rerio |
Alignment Length: | 199 | Identity: | 60/199 - (30%) |
---|---|---|---|
Similarity: | 92/199 - (46%) | Gaps: | 37/199 - (18%) |
- Green bases have known domain annotations that are detailed below.
Fly 183 DQW-----KSAKAASGDLIIIDLGSTLTNFKRYAMLDVLNTGAMIGQTLIDLTN-----KGVPQE 237
Fly 238 IIHLIGQGISAHVAGAAGNKYTAQTGHKLRRITGLDPAKVLSKRPQILGGLSRGDADFVDAIHTS 302
Fly 303 T-----FAMGTPIRCGDVDFYPNGPS------------------TGVPGSENVIE-AVARATRYF 343
Fly 344 AESV 347 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Yp3 | NP_001285228.1 | Lipase | 93..400 | CDD:278576 | 60/199 (30%) |
Abhydrolase | <215..396 | CDD:304388 | 55/162 (34%) | ||
lipca | NP_957316.1 | lipo_lipase | 44..488 | CDD:132274 | 60/199 (30%) |
Pancreat_lipase_like | 54..344 | CDD:238363 | 60/199 (30%) | ||
PLAT_LPL | 351..485 | CDD:238856 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_28N19 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 1 | 1.100 | - | - | O | PTHR11610 |
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
ZFIN | 0 | 0.000 | Not matched by this tool. | |||
3 | 2.910 |