DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Yp3 and CG6675

DIOPT Version :9

Sequence 1:NP_001285228.1 Gene:Yp3 / 32339 FlyBaseID:FBgn0004047 Length:420 Species:Drosophila melanogaster
Sequence 2:NP_610132.3 Gene:CG6675 / 35439 FlyBaseID:FBgn0032973 Length:390 Species:Drosophila melanogaster


Alignment Length:229 Identity:56/229 - (24%)
Similarity:101/229 - (44%) Gaps:30/229 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   186 KSAKAASGD--LIIIDLGSTLTNFKRYAMLDVLNT-GAMIGQTLIDLTNK-GVPQEIIHLIGQGI 246
            |:|....|:  :|::|..::..|...::::.::.| ||.:.|.:.:|..: |...:.::|||..:
  Fly   173 KNAYLKKGEYNVIVVDWSASSANINYFSVVKLIETFGAELAQFIRNLNRQFGADFDSMYLIGHSL 237

  Fly   247 SAHVAGAAGNKYTAQTGHKLRRITGLDPAKVLSKRPQILGGLSRGDADFVDAIHTS-TFAMGTPI 310
            .|.:||:||.:....   |:..|..||||....:.......:...||.:|:::||| .|....| 
  Fly   238 GAQIAGSAGKRLKPV---KVNTIFALDPAGPKFRHRGTEFRIDPSDAKYVESMHTSANFGFRRP- 298

  Fly   311 RCGDVDFYPN----GPSTGVPGSENVIEAVARATRYFAESVRPGSERNF---PAVPANSLKQ--Y 366
             .|...||||    ..|....|..::     |:.:.||||:  .|...|   |.:..|...|  |
  Fly   299 -TGSATFYPNYGAYQHSCYYLGCSHI-----RSYQMFAESI--NSPLGFWGTPCIRDNGRWQCDY 355

  Fly   367 KEQDGFGKRAYMGLQIDYDLRGDYILEVNAKSPF 400
            .::...    .|..:......|.:.::.::..||
  Fly   356 SQRQSI----QMAGEPSIHKEGIFYVKTSSSDPF 385

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Yp3NP_001285228.1 Lipase 93..400 CDD:278576 54/227 (24%)
Abhydrolase <215..396 CDD:304388 48/192 (25%)
CG6675NP_610132.3 Pancreat_lipase_like 116..381 CDD:238363 54/223 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45445887
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_28N19
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11610
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.