DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Yp3 and CG4267

DIOPT Version :9

Sequence 1:NP_001285228.1 Gene:Yp3 / 32339 FlyBaseID:FBgn0004047 Length:420 Species:Drosophila melanogaster
Sequence 2:NP_001259919.1 Gene:CG4267 / 33405 FlyBaseID:FBgn0264979 Length:374 Species:Drosophila melanogaster


Alignment Length:270 Identity:61/270 - (22%)
Similarity:108/270 - (40%) Gaps:56/270 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   161 AQEQQQQLKSSDYDYTSSEEAADQWKSAKAASGDLIIIDLGSTLTNFKRYAML-DVLNTGAMIGQ 224
            :|.:...::.....|.|..:.....:.|.....::|:.|...|.||...|.:. .|.:.||::.:
  Fly   116 SQSKGSHIRKVKNAYLSLTDPGPNGEPAPYEDFNVIVCDWSKTSTNVNYYEVAKTVEDMGALLAE 180

  Fly   225 TLIDLTNK--GVPQEIIHLIGQGISAHVAGAAGNKYTAQTGHKLRRITGLDPAKVLSKRPQILGG 287
             |:...|:  .:..:.:::||..:.|.:||:||.:...   ::...|..||||....:.......
  Fly   181 -LVRYLNQEANMHYDDVYVIGHSLGAQIAGSAGKQIMP---YRFNTIYALDPAGPQFREKSDEYR 241

  Fly   288 LSRGDADFVDAIHTS-TFAMGTPIRCGDVDFYPN-GPSTG---VPGSENVIEAVARATRYFAESV 347
            :...||.:|::|.|| :|....|:  |...|||| |.:..   |.|..:     .|:..||.||:
  Fly   242 IDASDASYVESIQTSVSFGFEQPV--GHATFYPNYGKNQKKCYVYGCSH-----KRSHDYFIESL 299

  Fly   348 R-------PGSERNFPAVPANSLKQYKEQDGFGKRAYMGLQIDYDLR----------GDYILEVN 395
            .       |..||:              .||    .::.|..|.:.|          |.:.::..
  Fly   300 TSPAGFWGPRCERH--------------DDG----TWLLLMSDGEFRMGGEPSIPKNGTFYVKTY 346

  Fly   396 AKSPF--GQR 403
            :|.|:  |.|
  Fly   347 SKPPYAMGHR 356

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Yp3NP_001285228.1 Lipase 93..400 CDD:278576 58/263 (22%)
Abhydrolase <215..396 CDD:304388 47/204 (23%)
CG4267NP_001259919.1 Lipase 64..351 CDD:278576 58/263 (22%)
Pancreat_lipase_like 71..347 CDD:238363 57/259 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45445886
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_28N19
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11610
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.