DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Yp3 and Yp1

DIOPT Version :9

Sequence 1:NP_001285228.1 Gene:Yp3 / 32339 FlyBaseID:FBgn0004047 Length:420 Species:Drosophila melanogaster
Sequence 2:NP_001285071.1 Gene:Yp1 / 31939 FlyBaseID:FBgn0004045 Length:439 Species:Drosophila melanogaster


Alignment Length:439 Identity:238/439 - (54%)
Similarity:321/439 - (73%) Gaps:28/439 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MMSLRICLLATCLLVAAHAS-----KDASNDRLKPTKWLTATELENVPSLNDITWERLENQPLEQ 60
            |..:|:..|..||.|||.|.     .::.|..|||::||:.::||.:|:|:|.|.|||||..||:
  Fly     1 MNPMRVLSLLACLAVAALAKPNGRMDNSVNQALKPSQWLSGSQLEAIPALDDFTIERLENMNLER 65

  Fly    61 GAKVIEKIYHVGQIKHDLTPSFVPSPSNVPVWIIKSNGQKVECKLNNYVETAKAQPGFGEDEVTI 125
            ||::::::||:.||.|::.|::|  ||.:.|::.|.||.|....||..::..|.:..||||||||
  Fly    66 GAELLQQVYHLSQIHHNVEPNYV--PSGIQVYVPKPNGDKTVAPLNEMIQRLKQKQNFGEDEVTI 128

  Fly   126 VLTGLPKTSPAQQKAMRRLIQAYVQKYNLQQLQKNAQEQQQQLKSSDYDY------------TSS 178
            ::||||:||...:||.|:|:|||:|:|||||       |:|..|:.:.||            |||
  Fly   129 IVTGLPQTSETVKKATRKLVQAYMQRYNLQQ-------QRQHGKNGNQDYQDQSNEQRKNQRTSS 186

  Fly   179 EE-AADQWKSAKAASGDLIIIDLGSTLTNFKRYAMLDVLNTGAMIGQTLIDLTNK-GVPQEIIHL 241
            || .:::.|:||..|||:|:|||||.|..::||||||:..|||.||:.::.:.|: .:|.:.|||
  Fly   187 EEDYSEEVKNAKTQSGDIIVIDLGSKLNTYERYAMLDIEKTGAKIGKWIVQMVNELDMPFDTIHL 251

  Fly   242 IGQGISAHVAGAAGNKYTAQTGHKLRRITGLDPAKVLSKRPQILGGLSRGDADFVDAIHTSTFAM 306
            |||.:.|||||||..::|..|||||||:|||||:|:::|....|.||:||||:||||||||.:.|
  Fly   252 IGQNVGAHVAGAAAQEFTRLTGHKLRRVTGLDPSKIVAKSKNTLTGLARGDAEFVDAIHTSVYGM 316

  Fly   307 GTPIRCGDVDFYPNGPSTGVPGSENVIEAVARATRYFAESVRPGSERNFPAVPANSLKQYKEQDG 371
            |||||.||||||||||:.||||:.||:||..|||||||||||||:||:|||||||||:|||:.||
  Fly   317 GTPIRSGDVDFYPNGPAAGVPGASNVVEAAMRATRYFAESVRPGNERSFPAVPANSLQQYKQNDG 381

  Fly   372 FGKRAYMGLQIDYDLRGDYILEVNAKSPFGQRSPAHKQAAYHGMHHAQN 420
            ||||||||:...:||.|||||:||.|||||:.:||.||::|||:|.|.|
  Fly   382 FGKRAYMGIDTAHDLEGDYILQVNPKSPFGRNAPAQKQSSYHGVHQAWN 430

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Yp3NP_001285228.1 Lipase 93..400 CDD:278576 185/320 (58%)
Abhydrolase <215..396 CDD:304388 119/181 (66%)
Yp1NP_001285071.1 Abhydrolase 183..406 CDD:304388 143/222 (64%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45438285
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_28N19
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0007604
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11610
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.840

Return to query results.
Submit another query.