DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Yp3 and Lipi

DIOPT Version :9

Sequence 1:NP_001285228.1 Gene:Yp3 / 32339 FlyBaseID:FBgn0004047 Length:420 Species:Drosophila melanogaster
Sequence 2:NP_001099369.1 Gene:Lipi / 288322 RGDID:1310162 Length:476 Species:Rattus norvegicus


Alignment Length:242 Identity:63/242 - (26%)
Similarity:101/242 - (41%) Gaps:49/242 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   194 DLIIIDLGSTLTNF-KRYAMLDVLNTGAMIGQTLIDLTNKGVPQEIIHLIGQGISAHVAGAAGNK 257
            :||::|.....|.| ...|:.:......::.:.:.:|...|...:..|.||..:.||:.|..|..
  Rat   123 NLIVVDWNQGATTFIYGRAVKNTRKVAEILREYIENLLIHGASLDNFHFIGMSLGAHICGFVGKL 187

  Fly   258 YTAQTGHKLRRITGLDPAKVLSKRPQILG-----GLSRGDADFVDAIHTSTFAMGTPIRCGDVDF 317
            :..|.|    ||||||||     .|:..|     .|...||.|||.||:.:...|.....|.:||
  Rat   188 FQGQLG----RITGLDPA-----GPKFSGKPSNCRLDYTDAKFVDVIHSDSQGFGILEPSGHIDF 243

  Fly   318 YPNG-------PSTGVPGSENVIEAVARATRYFAESVRPGSERNFPAVPANSLKQYKE------- 368
            ||||       |::.:.|.:.:.....||...|.|:..  :..||.:.|..|.:.||.       
  Rat   244 YPNGGRNQPGCPTSLLSGMDYIKCDHQRAVHLFLEAFE--TNCNFVSFPCRSYRDYKSGLCVGCG 306

  Fly   369 ---QDGFGKRAYMGLQI------------DYDLRGDYILEVNAKSPF 400
               :|...:   :|:|.            ::.||....|:.::::||
  Rat   307 NLYKDSCPR---LGIQANLWKEELKKKTEEWPLRTTAFLDTSSQNPF 350

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Yp3NP_001285228.1 Lipase 93..400 CDD:278576 61/240 (25%)
Abhydrolase <215..396 CDD:304388 55/214 (26%)
LipiNP_001099369.1 Pancreat_lipase_like 57..346 CDD:238363 61/236 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166338916
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_28N19
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11610
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.840

Return to query results.
Submit another query.