DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Yp3 and Pnlip

DIOPT Version :9

Sequence 1:NP_001285228.1 Gene:Yp3 / 32339 FlyBaseID:FBgn0004047 Length:420 Species:Drosophila melanogaster
Sequence 2:NP_037293.2 Gene:Pnlip / 25702 RGDID:3360 Length:465 Species:Rattus norvegicus


Alignment Length:280 Identity:78/280 - (27%)
Similarity:116/280 - (41%) Gaps:74/280 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   127 LTGLPKTSPAQQKAMRRLIQAYVQKYNLQQLQKNAQEQQQQLKSSDYDYTSS---------EEAA 182
            |..|| .||||... |.|:.....:.|.|::..:|    ..:::|::.....         ::..
  Rat    41 LKALP-WSPAQINT-RFLLYTNENQDNYQKITSDA----SSIRNSNFKTNRKTRIIIHGFIDKGE 99

  Fly   183 DQWKS------AKAASGDLIIIDL--GSTLTNFKRYAMLDVLNTGAMIGQTLIDL--TNKGVPQE 237
            :.|.|      .|..|.:.|.:|.  ||..|..:  |..:|...||.:. .|:::  ::.|...:
  Rat   100 ENWLSDMCKNMFKVESVNCICVDWKGGSRATYTQ--ATQNVRVVGAEVA-LLVNVLKSDLGYSPD 161

  Fly   238 IIHLIGQGISAHVAGAAGNKYTAQTGHKLRRITGLDPAKVLSKRPQILG-----GLSRGDADFVD 297
            .:||||..:.:||||.||.:.....|    ||||||.|:     |...|     .|...||.|||
  Rat   162 NVHLIGHSLGSHVAGEAGKRTFGAIG----RITGLDAAE-----PYFQGTPEEVRLDPTDAQFVD 217

  Fly   298 AIHTST--------FAMGTPIRCGDVDFYPNGPSTGVPG-SENV------IEAVARATRYFAESV 347
            ||||..        |.|...:  |.:||:||| ...:|| .:|:      |:.:...||.||   
  Rat   218 AIHTDAAPIIPNLGFGMSQTV--GHLDFFPNG-GMEMPGCQKNILSQIVDIDGIWEGTRDFA--- 276

  Fly   348 RPGSERNFPAVPANSLKQYK 367
                       ..|.|:.||
  Rat   277 -----------ACNHLRSYK 285

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Yp3NP_001285228.1 Lipase 93..400 CDD:278576 78/280 (28%)
Abhydrolase <215..396 CDD:304388 55/175 (31%)
PnlipNP_037293.2 Lipase 17..352 CDD:395099 78/280 (28%)
PLAT_PL 355..465 CDD:238857
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166338905
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_28N19
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11610
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.840

Return to query results.
Submit another query.