DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Yp3 and Lipc

DIOPT Version :9

Sequence 1:NP_001285228.1 Gene:Yp3 / 32339 FlyBaseID:FBgn0004047 Length:420 Species:Drosophila melanogaster
Sequence 2:XP_006510879.1 Gene:Lipc / 15450 MGIID:96216 Length:526 Species:Mus musculus


Alignment Length:278 Identity:71/278 - (25%)
Similarity:116/278 - (41%) Gaps:58/278 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   169 KSSDYDYTSSEEAADQW-----KSAKAASGDLIIIDLGSTLTNFKRYAMLDVLNTGAMIGQTLID 228
            |.||.|| ..:...:.|     .:.|:.....:.:.|...::...::..:.|.|| .::||.:..
Mouse   101 KDSDSDY-QVDGLLENWIWKIVSALKSRQSQPVNVGLVDWISLAYQHYTIAVQNT-RIVGQDVAA 163

  Fly   229 L-----TNKGVPQEIIHLIGQGISAHVAGAAGNKYTAQTGHKLRRITGLDPAKVLSKRPQILGGL 288
            |     .:....:..:||||..:.|||:|.||:....:  :|:.||||||||..:.:.......|
Mouse   164 LLLWLEESAKFSRSKVHLIGYSLGAHVSGFAGSSMDGK--NKIGRITGLDPAGPMFEGTSPNERL 226

  Fly   289 SRGDADFVDAIHTST-----FAMGTPIRCGDVDFYPNGPSTGVPG----------SENVIEAVA- 337
            |..||:|||||||.|     .::|........||||||.|. .||          :|:.:.|:. 
Mouse   227 SPDDANFVDAIHTFTREHMGLSVGIKQPIAHYDFYPNGGSF-QPGCHFLELYKHIAEHGLNAITQ 290

  Fly   338 -------RATRYFAESVRPGSERNFPAVPANSLKQYKEQDGFGKRAYMGLQ------IDYDLRGD 389
                   |:...|.:|::....::...       |..:...|.:...:..:      :.||:|.|
Mouse   291 TIKCAHERSVHLFIDSLQHSDLQSIGF-------QCSDMGSFSQGLCLSCKKGRCNTLGYDIRKD 348

  Fly   390 -------YILEVNAKSPF 400
                   ..|...|:|||
Mouse   349 RSGKSKRLFLITRAQSPF 366

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Yp3NP_001285228.1 Lipase 93..400 CDD:278576 69/276 (25%)
Abhydrolase <215..396 CDD:304388 59/221 (27%)
LipcXP_006510879.1 Lipase 18..366 CDD:333880 69/276 (25%)
PLAT_LPL 369..504 CDD:238856
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_28N19
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11610
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.910

Return to query results.
Submit another query.