DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Yp3 and Pnliprp2

DIOPT Version :9

Sequence 1:NP_001285228.1 Gene:Yp3 / 32339 FlyBaseID:FBgn0004047 Length:420 Species:Drosophila melanogaster
Sequence 2:NP_476554.1 Gene:Pnliprp2 / 117554 RGDID:620793 Length:482 Species:Rattus norvegicus


Alignment Length:363 Identity:82/363 - (22%)
Similarity:134/363 - (36%) Gaps:112/363 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    46 NDITWERLENQPLEQGAKVIEKIYHVGQIKHDLTPSFVPSPSNVPV-WIIKSNGQKVECKLNNYV 109
            ||..|..:..:||        ||             |..||.::.. :::.:|...     |||.
  Rat    43 NDKPWAGMLQRPL--------KI-------------FPWSPEDIDTRFLLYTNENP-----NNYQ 81

  Fly   110 ETAKAQPGFGEDEVTIVLTGLPKTSPAQ-QKAMRRLIQAYVQK----YNLQQLQKNAQEQQQQLK 169
            :.:..:|.      ||      |.|..| .:..|.::..::.|    :.|...:|..|.::....
  Rat    82 KISATEPD------TI------KFSNFQLDRKTRFIVHGFIDKGEDGWLLDMCKKMFQVEKVNCI 134

  Fly   170 SSDYDYTSSEEAADQWKSAKAASGDLIIIDLGSTLTNFKRYAMLDVLNTGAMIGQTLIDLTNKGV 234
            ..|:...|..|......:.:....::..              ::.||:            |..|.
  Rat   135 CVDWRRGSRTEYTQASYNTRVVGAEIAF--------------LVQVLS------------TEMGY 173

  Fly   235 PQEIIHLIGQGISAHVAGAAGNKYTAQTGHKLRRITGLDPAKVLSKRPQILG-----GLSRGDAD 294
            ..|.:||||..:.|||.|.||.:.....|    ||||||||:     |...|     .|...||.
  Rat   174 SPENVHLIGHSLGAHVVGEAGRRLEGHVG----RITGLDPAE-----PCFQGLPEEVRLDPSDAM 229

  Fly   295 FVDAIHTST------FAMGTPIRCGDVDFYPNGPSTGVPG-SENVIEAVA--------------- 337
            |||.|||.:      ...|...:.|.:||:||| ...:|| .:|::..:.               
  Rat   230 FVDVIHTDSAPIIPYLGFGMSQKVGHLDFFPNG-GKEMPGCQKNILSTIVDINGIWEGTQNFVAC 293

  Fly   338 ---RATRYFAESVRPGSERNFPAVPANSLKQYKEQDGF 372
               |:.:|:|.|:.  :...|...|.:|.:::::.|.|
  Rat   294 NHLRSYKYYASSIL--NPDGFLGYPCSSYEKFQQNDCF 329

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Yp3NP_001285228.1 Lipase 93..400 CDD:278576 72/315 (23%)
Abhydrolase <215..396 CDD:304388 54/188 (29%)
Pnliprp2NP_476554.1 Lipase 31..367 CDD:278576 82/363 (23%)
Pancreat_lipase_like 65..363 CDD:238363 72/320 (23%)
PLAT_PL 370..482 CDD:238857
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_28N19
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11610
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.