DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Yp3 and LOC100331214

DIOPT Version :9

Sequence 1:NP_001285228.1 Gene:Yp3 / 32339 FlyBaseID:FBgn0004047 Length:420 Species:Drosophila melanogaster
Sequence 2:XP_002666287.3 Gene:LOC100331214 / 100331214 -ID:- Length:501 Species:Danio rerio


Alignment Length:245 Identity:73/245 - (29%)
Similarity:110/245 - (44%) Gaps:46/245 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   149 VQKYNLQQLQKNAQE-----------QQQQLKSSDYDYTSS----------EEAADQWKSAKAAS 192
            |:|.|::...:|..:           :.:.|.|.::::||.          ....:.|.....|:
Zfish    48 VKKLNVKFSLRNPSQPDDDVCYIVRGKAETLSSCNFNHTSKTILVIHGWTVSGLFESWVEKLVAA 112

  Fly   193 -------GDLIIIDLGSTLTNFKRYAMLDVLNTGAMIGQTL--IDLTNKGVPQEIIHLIGQGISA 248
                   .::|::|...|..:....|..:....|..||..:  |:.|: .||.|.:||||..:.|
Zfish   113 LYNREKDANVIVVDWLDTAQDHYVVAAQNTKMVGREIGLFIDWIEETS-NVPLENLHLIGYSLGA 176

  Fly   249 HVAGAAGNKYTAQTGHKLRRITGLDPAKVLSKRPQILGGLSRGDADFVDAIHTST-----FAMGT 308
            ||||.||    :.|.:|:.||||||||....:.....|.||..||.|||.:||.|     .::|.
Zfish   177 HVAGFAG----SHTTNKIGRITGLDPAGPDFEGVHAHGRLSPDDAHFVDVLHTFTRGSLGLSIGI 237

  Fly   309 PIRCGDVDFYPNGPSTGVPGSENVIEAVARATRY--FA--ESVRPGSERN 354
            ....|.||.||||.|. .||. |:..|:.:...|  ||  .::|...||:
Zfish   238 EQPVGHVDIYPNGGSF-QPGC-NLRGALEKMASYGIFAINNAIRCEHERS 285

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Yp3NP_001285228.1 Lipase 93..400 CDD:278576 73/245 (30%)
Abhydrolase <215..396 CDD:304388 59/151 (39%)
LOC100331214XP_002666287.3 lipo_lipase 47..487 CDD:132274 73/245 (30%)
Pancreat_lipase_like 51..347 CDD:238363 71/242 (29%)
PLAT_LPL 355..485 CDD:238856
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_28N19
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11610
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.