DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Yp3 and lipib

DIOPT Version :9

Sequence 1:NP_001285228.1 Gene:Yp3 / 32339 FlyBaseID:FBgn0004047 Length:420 Species:Drosophila melanogaster
Sequence 2:XP_001342691.1 Gene:lipib / 100003046 ZFINID:ZDB-GENE-091118-47 Length:448 Species:Danio rerio


Alignment Length:149 Identity:50/149 - (33%)
Similarity:69/149 - (46%) Gaps:12/149 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly   190 AASGD--LIIIDLGSTLTNFKRY-AMLDVLNTGAMIGQTLIDLTNKGVPQEIIHLIGQGISAHVA 251
            ||..|  ::::|......|.... |:.:...|...|.:.:..:..:|...:.|||||..:.||||
Zfish   100 AAQKDMNILVVDWNRGAANLNYLTAVANTRGTALNITRFIESMEKEGASLDSIHLIGVSLGAHVA 164

  Fly   252 GAAGNKYTAQTGHKLRRITGLDPAKVL--SKRPQILGGLSRGDADFVDAIHTSTFAMGTPIRCGD 314
            |..|    |..|.::.||||||||..:  |..|:  ..|...||.|||.:||...:.|.....|.
Zfish   165 GFIG----AMLGGRVGRITGLDPAGPMFASVSPE--ERLDPTDAQFVDVLHTDMNSFGLRGTHGH 223

  Fly   315 VDFYPNGPSTGVPGSENVI 333
            :|||.|| ....||....|
Zfish   224 IDFYANG-GLDQPGCPKTI 241

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Yp3NP_001285228.1 Lipase 93..400 CDD:278576 50/149 (34%)
Abhydrolase <215..396 CDD:304388 44/121 (36%)
lipibXP_001342691.1 Lipase 37..328 CDD:278576 50/149 (34%)
Pancreat_lipase_like 40..324 CDD:238363 50/149 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11610
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.