DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rtc1 and Rcl1

DIOPT Version :9

Sequence 1:NP_572919.1 Gene:Rtc1 / 32338 FlyBaseID:FBgn0020909 Length:384 Species:Drosophila melanogaster
Sequence 2:NP_067500.1 Gene:Rcl1 / 59028 MGIID:1913275 Length:373 Species:Mus musculus


Alignment Length:378 Identity:201/378 - (53%)
Similarity:269/378 - (71%) Gaps:8/378 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 IAQEGNCLIYRGSNFLKQRLILACLSGKPVKISQIRSEDETAPGLREYEISLIRLLDKITNGTKI 68
            :|.:.:.|.|.|.|||:|||:|:.|||:||||.:||:.|:. ||||::|.|.||||||||||::|
Mouse     1 MATQAHSLSYAGCNFLRQRLVLSTLSGRPVKIRRIRARDDN-PGLRDFEASFIRLLDKITNGSRI 64

  Fly    69 ELNPAGTSVMFSPGLLHGGQLNHDCCVQRGIGYYLDALIALGPFCKSPLQCTLRGVTNSKDSPSV 133
            |:|..||::.:.||||:||.:.|||.|.|||||||:||:.|.||.|.||:..||||||.:..|||
Mouse    65 EINQTGTTLYYQPGLLYGGSVEHDCSVLRGIGYYLEALLCLAPFMKHPLKIVLRGVTNDQVDPSV 129

  Fly   134 DHIKGAALSLLKRFLLVDEGLELKVVRRGVAPLGGGEIIFRCPVRKSLRAIQFQSQGMVKRIRGT 198
            |.:|..||.|||:|.:..|..|||::|||:.|.||||::|.|||||.|:.:|....|.:|||||.
Mouse   130 DVLKATALPLLKQFGIDGESFELKILRRGMPPGGGGEVLFSCPVRKVLKPVQLTDPGKIKRIRGM 194

  Fly   199 VYACKVSPAMANRTVEAAKGCMLKFLPDVYIYTDQNKGKMSGNSPGFGICLIAETTDGVCFAADC 263
            .|:.:|||.||||.|::|:..:.||:||:|||||..||..||.|||||:.|:||||:|...:|:.
Mouse   195 AYSVRVSPQMANRIVDSARSILNKFIPDIYIYTDHMKGVSSGKSPGFGLSLVAETTNGTFLSAEL 259

  Fly   264 CSNTREESEDTPSIPENLGKEVALRLLDEIYRGGCVDSSYQWLAALYIALGQKHVSKFLTGALSN 328
            .||  .:.:....:||:||:..|..||:||||||||||:.|.|..|.:.|||:.|||.|.|.||.
Mouse   260 ASN--PQGQGAAVLPEDLGRNCAKLLLEEIYRGGCVDSTNQSLVLLLMTLGQQDVSKVLLGPLSP 322

  Fly   329 YTVHFLQHLRDFFSITFKLENPEAEDEDEAENVRGAQKVLMACVGIGYTNINK 381
            ||:.||:||:.||.:.||:|....     .|.::|..||||.|||||::|::|
Mouse   323 YTIEFLRHLKSFFQVMFKVETKPC-----GEELKGGDKVLMTCVGIGFSNLSK 370

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rtc1NP_572919.1 RNA_Cyclase_Class_I 7..349 CDD:238447 186/341 (55%)
18S_RNA_Rcl1p 11..384 CDD:274564 200/371 (54%)
Rcl1NP_067500.1 RNA_Cyclase_Class_I 4..343 CDD:238447 186/341 (55%)
18S_RNA_Rcl1p 8..371 CDD:274564 200/371 (54%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167831281
Domainoid 1 1.000 378 1.000 Domainoid score I855
eggNOG 1 0.900 - - E1_COG0430
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H4217
Inparanoid 1 1.050 406 1.000 Inparanoid score I1880
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53579
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0004680
OrthoInspector 1 1.000 - - oto94984
orthoMCL 1 0.900 - - OOG6_102522
Panther 1 1.100 - - LDO PTHR11096
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1075
SonicParanoid 1 1.000 - - X3288
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1514.790

Return to query results.
Submit another query.