DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rtc1 and rtca

DIOPT Version :9

Sequence 1:NP_572919.1 Gene:Rtc1 / 32338 FlyBaseID:FBgn0020909 Length:384 Species:Drosophila melanogaster
Sequence 2:NP_955830.1 Gene:rtca / 321129 ZFINID:ZDB-GENE-030131-9687 Length:363 Species:Danio rerio


Alignment Length:373 Identity:104/373 - (27%)
Similarity:170/373 - (45%) Gaps:37/373 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 GSNFLKQRLILACLSGKPVKISQIRSEDETAPGLREYEISLIRLLDKITNGTKIELNPAGTSVMF 79
            |...|:....|:|:.|..:||::||:...| ||||...:|.:.||..:.||.........:.:..
Zfish    16 GGQILRVSAALSCIQGASIKINKIRAGRST-PGLRPQHLSGLELLRDMCNGNLEGATVGSSEITL 79

  Fly    80 SPGLLHGGQLNH--DCCVQRGIGYYLDALIALGPFCKSPLQCTLRGVTNSKDSPSVDHIKGAALS 142
            :||.:.||  ||  |......:...:...:....|.:.|.:..|:|.||::.:|.:|:.......
Zfish    80 TPGKIKGG--NHIADTHTAGSVTLLMQVSLPCALFAQGPSELCLKGGTNAEMAPQIDYTVKVFKP 142

  Fly   143 LLKRFLLVDEGLELKVVRRGVAPLGGGEIIFRCPVRKSLRAIQFQSQGMVKRIRGTVYACKVSP- 206
            :::|| .|....:|::  ||..|.||||::.:....|.|..|....:|.:.:|.|..:...|.| 
Zfish   143 IVERF-GVQFDCDLRM--RGYYPKGGGEVVLKVNPAKELSPINMTERGNITKIYGRAFVAGVLPF 204

  Fly   207 AMANRTVEAAKGCMLKFLPDVYIYTD--QNKGKMSGNSPGFGICLIAETTDGVCFAADCCSNTRE 269
            .:|.....||...:.|.:.|:||...  |.|.|..||  |.||.:|||::.|..||.........
Zfish   205 KLAKDMSTAAIRTIRKEIKDLYINIQSLQEKDKACGN--GNGIIIIAESSTGCIFAGSSLGKKGV 267

  Fly   270 ESEDTPSIPENLGKEVALRLLDEIYRGGCVDSSYQWLAALYIALGQKHVSKFLTGALSNYT---V 331
            .:       :.:|.|.|..||..|...||||...|....:::||. ...|:..||.::.:|   :
Zfish   268 YA-------DKVGIEAAEMLLRNIRHNGCVDEFLQDQLIIFMALA-NGTSRMRTGPITLHTQTAI 324

  Fly   332 HFLQHLRDF-FSITFKLENPEAEDEDEAENVRGAQKVLMACVGIGYTN 378
            |..:.|.:. |:|:      :||||:..:.      .::.|.|:|.||
Zfish   325 HVAEQLTNAKFAIS------KAEDENANDT------YIIECQGVGATN 360

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rtc1NP_572919.1 RNA_Cyclase_Class_I 7..349 CDD:238447 95/342 (28%)
18S_RNA_Rcl1p 11..384 CDD:274564 104/373 (28%)
rtcaNP_955830.1 RNA_Cyclase_Class_II 8..339 CDD:238446 95/344 (28%)
RTC 12..337 CDD:279479 94/336 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0430
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.