DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rtc1 and rcl1

DIOPT Version :9

Sequence 1:NP_572919.1 Gene:Rtc1 / 32338 FlyBaseID:FBgn0020909 Length:384 Species:Drosophila melanogaster
Sequence 2:XP_031746505.1 Gene:rcl1 / 100497943 XenbaseID:XB-GENE-962711 Length:372 Species:Xenopus tropicalis


Alignment Length:380 Identity:203/380 - (53%)
Similarity:273/380 - (71%) Gaps:9/380 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 IAQEGNCLIYRGSNFLKQRLILACLSGKPVKISQIRSEDETAPGLREYEISLIRLLDKITNGTKI 68
            :|.:||||.|.|.||.:||::|:.|||:||||..||.:|| :||:|::|.|.|||:|||||||:|
 Frog     1 MASQGNCLRYEGCNFFRQRIVLSTLSGRPVKIQGIRVKDE-SPGIRDFEASFIRLMDKITNGTRI 64

  Fly    69 ELNPAGTSVMFSPGLLHGGQLNHDCCVQRGIGYYLDALIALGPFCKSPLQCTLRGVTNSKDSPSV 133
            |:|..|||:.:.||||.||.|.|||.:||.|||||::|:.|.||.|.|::.|||||||.:..|||
 Frog    65 EINETGTSLYYLPGLLSGGTLEHDCNIQRSIGYYLESLLCLAPFMKHPIKITLRGVTNDQADPSV 129

  Fly   134 DHIKGAALSLLKRFLLVDEGLELKVVRRGVAPLGGGEIIFRCPVRKSLRAIQFQSQGMVKRIRGT 198
            |.:|..|:.|:|:|.:..|..|||:|:||:.|.||||:||.|||||.||.:|....|.:|||||.
 Frog   130 DTLKATAIPLMKKFGIDGEHFELKIVKRGMPPGGGGEVIFSCPVRKLLRPVQLTDPGKIKRIRGV 194

  Fly   199 VYACKVSPAMANRTVEAAKGCMLKFLPDVYIYTDQNKGKMSGNSPGFGICLIAETTDGVCFAADC 263
            .|:.:|||.:.||.|:||:..:.:||||:|||||..||..||.|||||:.|:||||:|...:.:.
 Frog   195 AYSVRVSPQIGNRIVDAARSVLNRFLPDIYIYTDHMKGANSGKSPGFGLSLVAETTEGCFLSTEL 259

  Fly   264 CSNTREESEDTPSIPENLGKEVALRLLDEIYRGGCVDSSYQWLAALYIALGQKHVSKFLTGALSN 328
            .||  .:.:.:..:||:||:..|:.||:||||||||||..|.|..|.:.|||:.|||.|.|.||.
 Frog   260 ASN--PQGQGSTVLPEDLGRNCAVLLLEEIYRGGCVDSVNQSLVLLLMTLGQQDVSKVLLGPLSP 322

  Fly   329 YTVHFLQHLRDFFSITFKLENPEAEDEDEAENVRGAQKVLMACVGIGYTNINKRV 383
            ||:.||:|||.||.|.||:|:...|:.      :||:|||:.|||:||:|::|.|
 Frog   323 YTIEFLRHLRSFFQIMFKMESKTFEER------KGAEKVLLTCVGVGYSNLSKPV 371

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rtc1NP_572919.1 RNA_Cyclase_Class_I 7..349 CDD:238447 187/341 (55%)
18S_RNA_Rcl1p 11..384 CDD:274564 199/373 (53%)
rcl1XP_031746505.1 18S_RNA_Rcl1p 8..369 CDD:274564 197/369 (53%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 374 1.000 Domainoid score I872
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H4217
Inparanoid 1 1.050 414 1.000 Inparanoid score I1799
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1423847at2759
OrthoFinder 1 1.000 - - FOG0004680
OrthoInspector 1 1.000 - - oto105171
Panther 1 1.100 - - LDO PTHR11096
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X3288
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
88.160

Return to query results.
Submit another query.