DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11151 and STOML1

DIOPT Version :10

Sequence 1:NP_572917.1 Gene:CG11151 / 32335 FlyBaseID:FBgn0030519 Length:115 Species:Drosophila melanogaster
Sequence 2:NP_004800.2 Gene:STOML1 / 9399 HGNCID:14560 Length:398 Species:Homo sapiens


Alignment Length:109 Identity:25/109 - (22%)
Similarity:47/109 - (43%) Gaps:9/109 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 QKIIDGLKE------NEAKAKAVNGVFLYKITKDGKVAKEWTLDCKNAKAY--EGPAQGIKVDTT 66
            |.:.:||..      :||....|...:.:.:.........:.||....:..  .|...||. |..
Human   288 QPLAEGLLTALQPFLSEALVSQVGACYQFNVVLPSGTQSAYFLDLTTGRGRVGHGVPDGIP-DVV 351

  Fly    67 LTVADEDMVDIALGKLNPQAAFMKGKLKIAGNIMLTQKLAPLLK 110
            :.:|:.|:..:...:|.|..|:|.|:||:.|::.:..||..:|:
Human   352 VEMAEADLRALLCRELRPLGAYMSGRLKVKGDLAMAMKLEAVLR 395

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11151NP_572917.1 SCP2 9..110 CDD:460423 24/107 (22%)
STOML1NP_004800.2 Tyrosine-type lysosomal sorting signal. /evidence=ECO:0000255, ECO:0000269|PubMed:19696025 6..10
SPFH_SLP-1 94..224 CDD:259814
SCP2 311..395 CDD:460423 18/84 (21%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.