DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11151 and FOX2

DIOPT Version :9

Sequence 1:NP_001259531.1 Gene:CG11151 / 32335 FlyBaseID:FBgn0030519 Length:115 Species:Drosophila melanogaster
Sequence 2:NP_012934.1 Gene:FOX2 / 853878 SGDID:S000001717 Length:900 Species:Saccharomyces cerevisiae


Alignment Length:106 Identity:28/106 - (26%)
Similarity:38/106 - (35%) Gaps:31/106 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 FQKIID-----GLKENEAKAKAVNGVFLYKITKDGKVAKEWTLDCKNAKAYEGPAQGIKVDTTLT 68
            |.:||:     ||..|..:|.       |...|.|.|....||      |.||....|.|::...
Yeast   144 FGRIINTASPAGLFGNFGQAN-------YSAAKMGLVGLAETL------AKEGAKYNINVNSIAP 195

  Fly    69 VADEDMVDIALGKLNPQAAFMKGKLKIAGNIMLTQKLAPLL 109
            :|...|.:   ..|.|..      ||..|    .:|:.||:
Yeast   196 LARSRMTE---NVLPPHI------LKQLG----PEKIVPLV 223

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11151NP_001259531.1 SCP2 9..109 CDD:396566 27/104 (26%)
FOX2NP_012934.1 hydroxyacyl-CoA-like_DH_SDR_c-like 5..255 CDD:187611 28/106 (26%)
NADB_Rossmann 336..566 CDD:419666
PLN02864 613..886 CDD:178455
HDE_HSD 782..894 CDD:239532
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2120
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.030

Return to query results.
Submit another query.