DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11151 and HSDL2

DIOPT Version :10

Sequence 1:NP_572917.1 Gene:CG11151 / 32335 FlyBaseID:FBgn0030519 Length:115 Species:Drosophila melanogaster
Sequence 2:NP_115679.2 Gene:HSDL2 / 84263 HGNCID:18572 Length:418 Species:Homo sapiens


Alignment Length:114 Identity:36/114 - (31%)
Similarity:61/114 - (53%) Gaps:10/114 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 DAVFQKIIDGLKENEAKAKAVNGVFLYKITKDGKVAKEWTLDCKNA---KAYEGPAQGIKVDTTL 67
            :..|:.:.|.|.::  ..||...::|::::  |:....|.||.|:.   ..|..|:.  :.|..:
Human   311 EETFRIVKDSLSDD--VVKATQAIYLFELS--GEDGGTWFLDLKSKGGNVGYGEPSD--QADVVM 369

  Fly    68 TVADEDMVDIALGKLNPQAAFMKGKLKIAGNIMLTQKLAPLL-KTDAKL 115
            ::..:|.|.:..|||.|..|||.|||||.||:.|..||..|: :.:|:|
Human   370 SMTTDDFVKMFSGKLKPTMAFMSGKLKIKGNMALAIKLEKLMNQMNARL 418

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11151NP_572917.1 SCP2 9..110 CDD:460423 34/104 (33%)
HSDL2NP_115679.2 HSDL2_SDR_c 8..248 CDD:187663
SCP2 311..414 CDD:442486 34/108 (31%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.