DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11151 and SCP2

DIOPT Version :10

Sequence 1:NP_572917.1 Gene:CG11151 / 32335 FlyBaseID:FBgn0030519 Length:115 Species:Drosophila melanogaster
Sequence 2:NP_199103.1 Gene:SCP2 / 834300 AraportID:AT5G42890 Length:123 Species:Arabidopsis thaliana


Alignment Length:109 Identity:36/109 - (33%)
Similarity:57/109 - (52%) Gaps:4/109 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 LQSDAVFQKIIDGLKENEAKAKAVNGVFLYKIT----KDGKVAKEWTLDCKNAKAYEGPAQGIKV 63
            |:|||:...:.:.|..:..|........:|:|.    |.|.....:.:|.|..:..:|..:|.||
plant     6 LKSDAIMDMMKEHLSTDAGKEVTEKIGLVYQINIAPKKLGFEEVTYIVDLKKGEVTKGKYEGGKV 70

  Fly    64 DTTLTVADEDMVDIALGKLNPQAAFMKGKLKIAGNIMLTQKLAP 107
            |.|.:..|:|.|.:|.||:|||.||::|.:||.|::...||..|
plant    71 DATFSFKDDDFVKVATGKMNPQMAFIRGAMKIKGSLSAAQKFTP 114

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11151NP_572917.1 SCP2 9..110 CDD:460423 32/103 (31%)
SCP2NP_199103.1 SCP2 32..112 CDD:460423 28/79 (35%)

Return to query results.
Submit another query.