DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11151 and Hsd17b4

DIOPT Version :9

Sequence 1:NP_001259531.1 Gene:CG11151 / 32335 FlyBaseID:FBgn0030519 Length:115 Species:Drosophila melanogaster
Sequence 2:NP_077368.2 Gene:Hsd17b4 / 79244 RGDID:621806 Length:735 Species:Rattus norvegicus


Alignment Length:117 Identity:61/117 - (52%)
Similarity:80/117 - (68%) Gaps:4/117 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 SLQSDAVFQKIIDGLKE-NEAKAKAVNGVFLYKITKDGKVAKEWTLDCKN--AKAYEGPAQGIKV 63
            :|||..||.:|...||: .....|.||.||.:.|||:|.||.:||:|.||  .:.|:|||:| ..
  Rat   620 ALQSALVFGEIGRRLKDVGREVVKKVNAVFEWHITKNGNVAAKWTIDLKNGSGEVYQGPAKG-SA 683

  Fly    64 DTTLTVADEDMVDIALGKLNPQAAFMKGKLKIAGNIMLTQKLAPLLKTDAKL 115
            |||:|::|||.:::.|||||||.||..|:||..|||||:|||..:||..|||
  Rat   684 DTTITISDEDFMEVVLGKLNPQNAFFSGRLKARGNIMLSQKLQMILKDYAKL 735

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 591.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
CG11151NP_001259531.1 SCP2 9..109 CDD:396566 52/102 (51%)
Hsd17b4NP_077368.2 (3R)-hydroxyacyl-CoA dehydrogenase 1..305
hydroxyacyl-CoA-like_DH_SDR_c-like 5..254 CDD:187611
fabG 6..226 CDD:235546