DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11151 and stoml1

DIOPT Version :9

Sequence 1:NP_001259531.1 Gene:CG11151 / 32335 FlyBaseID:FBgn0030519 Length:115 Species:Drosophila melanogaster
Sequence 2:NP_001039193.1 Gene:stoml1 / 734047 XenbaseID:XB-GENE-990189 Length:361 Species:Xenopus tropicalis


Alignment Length:91 Identity:24/91 - (26%)
Similarity:43/91 - (47%) Gaps:0/91 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 EAKAKAVNGVFLYKITKDGKVAKEWTLDCKNAKAYEGPAQGIKVDTTLTVADEDMVDIALGKLNP 84
            |:....|...:...:|..|....|:.||.|:.....|.......|.||.:.:.|::.:..|.|:|
 Frog   267 ESLVSEVGSSYQLYVTMPGGQISEYFLDLKSGSGNCGWGVHPCPDVTLEMTEADLMSLICGDLHP 331

  Fly    85 QAAFMKGKLKIAGNIMLTQKLAPLLK 110
            ..|:..|:|:::|||....:|..:|:
 Frog   332 LTAYTGGRLRVSGNIQTALQLERVLR 357

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11151NP_001259531.1 SCP2 9..109 CDD:396566 23/88 (26%)
stoml1NP_001039193.1 PHB 60..198 CDD:214581
SPFH_SLP-1 75..205 CDD:259814
SCP2 254..357 CDD:280250 23/89 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.