DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11151 and stoml1

DIOPT Version :10

Sequence 1:NP_572917.1 Gene:CG11151 / 32335 FlyBaseID:FBgn0030519 Length:115 Species:Drosophila melanogaster
Sequence 2:NP_001039193.1 Gene:stoml1 / 734047 XenbaseID:XB-GENE-990189 Length:361 Species:Xenopus tropicalis


Alignment Length:91 Identity:24/91 - (26%)
Similarity:43/91 - (47%) Gaps:0/91 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 EAKAKAVNGVFLYKITKDGKVAKEWTLDCKNAKAYEGPAQGIKVDTTLTVADEDMVDIALGKLNP 84
            |:....|...:...:|..|....|:.||.|:.....|.......|.||.:.:.|::.:..|.|:|
 Frog   267 ESLVSEVGSSYQLYVTMPGGQISEYFLDLKSGSGNCGWGVHPCPDVTLEMTEADLMSLICGDLHP 331

  Fly    85 QAAFMKGKLKIAGNIMLTQKLAPLLK 110
            ..|:..|:|:::|||....:|..:|:
 Frog   332 LTAYTGGRLRVSGNIQTALQLERVLR 357

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11151NP_572917.1 SCP2 9..110 CDD:460423 23/89 (26%)
stoml1NP_001039193.1 SPFH_SLP-1 75..205 CDD:259814
SCP2 254..359 CDD:442486 24/91 (26%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.