DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11151 and Stoml1

DIOPT Version :10

Sequence 1:NP_572917.1 Gene:CG11151 / 32335 FlyBaseID:FBgn0030519 Length:115 Species:Drosophila melanogaster
Sequence 2:NP_081218.3 Gene:Stoml1 / 69106 MGIID:1916356 Length:399 Species:Mus musculus


Alignment Length:109 Identity:26/109 - (23%)
Similarity:47/109 - (43%) Gaps:9/109 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 QKIIDGLKE------NEAKAKAVNGVFLYKITKDGKVAKEWTLDCK--NAKAYEGPAQGIKVDTT 66
            |.:.:||..      :||....|...:.:.:.........:.||..  ..:...|...||. |..
Mouse   289 QPVAEGLLTALQPFLSEALVSQVGACYQFNVILPSGTQSIYFLDLTTGQGRVGHGEPDGIP-DVV 352

  Fly    67 LTVADEDMVDIALGKLNPQAAFMKGKLKIAGNIMLTQKLAPLLK 110
            :.:|:.|:..:...:|.|..|:|.|:||:.|::.:..||..:||
Mouse   353 VEMAEADLQALLSKELRPLGAYMSGRLKVKGDLAVVMKLEAVLK 396

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11151NP_572917.1 SCP2 9..110 CDD:460423 24/107 (22%)
Stoml1NP_081218.3 Tyrosine-type lysosomal sorting signal. /evidence=ECO:0000250|UniProtKB:Q9UBI4, ECO:0000255 6..10
SPFH_SLP-1 94..224 CDD:259814
SCP2 312..396 CDD:460423 18/84 (21%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.