DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11151 and hsd17b4

DIOPT Version :9

Sequence 1:NP_001259531.1 Gene:CG11151 / 32335 FlyBaseID:FBgn0030519 Length:115 Species:Drosophila melanogaster
Sequence 2:NP_001027490.1 Gene:hsd17b4 / 613082 XenbaseID:XB-GENE-1010432 Length:740 Species:Xenopus tropicalis


Alignment Length:116 Identity:60/116 - (51%)
Similarity:79/116 - (68%) Gaps:4/116 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 LQSDAVFQKIIDGLKE-NEAKAKAVNGVFLYKITKDGKVAKEWTLDCK--NAKAYEGPAQGIKVD 64
            ||||.||.:|...:|: .|...|.||.||.:.||||||.|.:||:|.|  :.:.|.|.|:| :.|
 Frog   626 LQSDLVFDEISRRVKDLGEQLVKKVNAVFQWDITKDGKPASQWTIDLKSGSGEVYRGKARG-RAD 689

  Fly    65 TTLTVADEDMVDIALGKLNPQAAFMKGKLKIAGNIMLTQKLAPLLKTDAKL 115
            |:.|::|||.:::.||.||||.||..||||:.|||||:|||..:||..|||
 Frog   690 TSFTLSDEDFMELVLGNLNPQKAFFAGKLKVKGNIMLSQKLEMILKDYAKL 740

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11151NP_001259531.1 SCP2 9..109 CDD:396566 50/102 (49%)
hsd17b4NP_001027490.1 hydroxyacyl-CoA-like_DH_SDR_c-like 6..255 CDD:187611
PLN02864 318..615 CDD:178455
SCP2 632..735 CDD:376720 50/103 (49%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 97 1.000 Domainoid score I7181
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2120
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
33.030

Return to query results.
Submit another query.