DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11151 and scp2b

DIOPT Version :9

Sequence 1:NP_001259531.1 Gene:CG11151 / 32335 FlyBaseID:FBgn0030519 Length:115 Species:Drosophila melanogaster
Sequence 2:NP_001006093.1 Gene:scp2b / 450073 ZFINID:ZDB-GENE-041010-196 Length:142 Species:Danio rerio


Alignment Length:108 Identity:47/108 - (43%)
Similarity:65/108 - (60%) Gaps:4/108 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 QSDAVFQKIIDGLKEN-EAKAKAVNGVFLYKITKDGKVAKE--WTLDCKNAKAYEGPAQGIKVDT 65
            ::.||||:|...|:|: |...|.:.|||.:|: |||...||  |.:|.||.|.........|.|.
Zfish    27 KAHAVFQEINKKLQEDGEQFVKKIGGVFAFKV-KDGPEGKEAVWIVDVKNGKGSVHNDSDKKADC 90

  Fly    66 TLTVADEDMVDIALGKLNPQAAFMKGKLKIAGNIMLTQKLAPL 108
            |:.:||.|::|:..||:|||.||.:|||||.||:.:..||..|
Zfish    91 TIAMADSDLLDLMTGKMNPQTAFFQGKLKITGNMGMAMKLQNL 133

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11151NP_001259531.1 SCP2 9..109 CDD:396566 45/103 (44%)
scp2bNP_001006093.1 SCP2 38..133 CDD:280250 41/95 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 81 1.000 Inparanoid score I5186
OMA 1 1.010 - - QHG57782
OrthoDB 1 1.010 - - D1490913at2759
OrthoFinder 1 1.000 - - FOG0006583
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_106080
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
76.880

Return to query results.
Submit another query.