DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11151 and ScpX

DIOPT Version :9

Sequence 1:NP_001259531.1 Gene:CG11151 / 32335 FlyBaseID:FBgn0030519 Length:115 Species:Drosophila melanogaster
Sequence 2:NP_524715.2 Gene:ScpX / 44183 FlyBaseID:FBgn0015808 Length:544 Species:Drosophila melanogaster


Alignment Length:111 Identity:35/111 - (31%)
Similarity:56/111 - (50%) Gaps:15/111 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 DAVFQKIIDGLKENEAKAKAVNGVFLYKITK--DGKVAKEWTLDCKNAKA---YEGPAQGIKVDT 65
            :...|:..|.|.|   |.:|:.|   :|:..  :|:.. .|.:|.|..|.   :.|..   |.|.
  Fly   432 EQAMQEDKDNLIE---KVRAIYG---FKVNNGPNGQTG-FWVIDAKQGKGKIIFNGTQ---KCDV 486

  Fly    66 TLTVADEDMVDIALGKLNPQAAFMKGKLKIAGNIMLTQKLAPLLKT 111
            |..::|:|:.::..|||.||.||.:||:||.||:....||..|.::
  Fly   487 TFIISDDDVFELLTGKLPPQKAFFQGKIKIQGNMGFAMKLMDLQRS 532

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11151NP_001259531.1 SCP2 9..109 CDD:396566 34/104 (33%)
ScpXNP_524715.2 PRK08256 5..396 CDD:181327
SCP-x_thiolase 9..395 CDD:238425
SCP2 429..529 CDD:280250 34/106 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4170
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.