DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11151 and ScpX

DIOPT Version :10

Sequence 1:NP_572917.1 Gene:CG11151 / 32335 FlyBaseID:FBgn0030519 Length:115 Species:Drosophila melanogaster
Sequence 2:NP_524715.2 Gene:ScpX / 44183 FlyBaseID:FBgn0015808 Length:544 Species:Drosophila melanogaster


Alignment Length:111 Identity:35/111 - (31%)
Similarity:56/111 - (50%) Gaps:15/111 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 DAVFQKIIDGLKENEAKAKAVNGVFLYKITK--DGKVAKEWTLDCKNAKA---YEGPAQGIKVDT 65
            :...|:..|.|.|   |.:|:.|   :|:..  :|:.. .|.:|.|..|.   :.|..   |.|.
  Fly   432 EQAMQEDKDNLIE---KVRAIYG---FKVNNGPNGQTG-FWVIDAKQGKGKIIFNGTQ---KCDV 486

  Fly    66 TLTVADEDMVDIALGKLNPQAAFMKGKLKIAGNIMLTQKLAPLLKT 111
            |..::|:|:.::..|||.||.||.:||:||.||:....||..|.::
  Fly   487 TFIISDDDVFELLTGKLPPQKAFFQGKIKIQGNMGFAMKLMDLQRS 532

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11151NP_572917.1 SCP2 9..110 CDD:460423 35/105 (33%)
ScpXNP_524715.2 PRK08256 5..396 CDD:181327
SCP2 428..531 CDD:460423 35/108 (32%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.