DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11151 and euc

DIOPT Version :9

Sequence 1:NP_001259531.1 Gene:CG11151 / 32335 FlyBaseID:FBgn0030519 Length:115 Species:Drosophila melanogaster
Sequence 2:NP_001247188.1 Gene:euc / 42271 FlyBaseID:FBgn0038665 Length:112 Species:Drosophila melanogaster


Alignment Length:97 Identity:30/97 - (30%)
Similarity:47/97 - (48%) Gaps:3/97 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 LQSDAVFQKIIDGLKENEAKAKAVNGVFLYKIT-KDGKVAKEWTLDCKNAKAYEGPAQGIKVDTT 66
            ::||.:.:||.:.|||::...:.|...|.:..| .||.:.|....|.|....|||.|  ..||..
  Fly     1 MKSDEIIEKIRNKLKESDPARRTVVNTFQFNFTDADGNLIKSMVFDFKALDIYEGSA--TSVDAQ 63

  Fly    67 LTVADEDMVDIALGKLNPQAAFMKGKLKIAGN 98
            :|::|||...:...:...|....:.|.||.|:
  Fly    64 VTISDEDFYLVGTKQKTFQEVLQQEKAKIDGD 95

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11151NP_001259531.1 SCP2 9..109 CDD:396566 28/91 (31%)
eucNP_001247188.1 SCP2 7..95 CDD:294753 27/89 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4170
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10094
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.