DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11151 and HSD17B4

DIOPT Version :9

Sequence 1:NP_001259531.1 Gene:CG11151 / 32335 FlyBaseID:FBgn0030519 Length:115 Species:Drosophila melanogaster
Sequence 2:NP_001186220.1 Gene:HSD17B4 / 3295 HGNCID:5213 Length:761 Species:Homo sapiens


Alignment Length:116 Identity:57/116 - (49%)
Similarity:77/116 - (66%) Gaps:4/116 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 LQSDAVFQKIIDGLKE-NEAKAKAVNGVFLYKITKDGKVAKEWTLDCK--NAKAYEGPAQGIKVD 64
            |||..||::|...||: .....|.||.||.:.|||.|.:..:||:|.|  :.|.|:|||:| ..|
Human   647 LQSTFVFEEIGRRLKDIGPEVVKKVNAVFEWHITKGGNIGAKWTIDLKSGSGKVYQGPAKG-AAD 710

  Fly    65 TTLTVADEDMVDIALGKLNPQAAFMKGKLKIAGNIMLTQKLAPLLKTDAKL 115
            ||:.::|||.:::.||||:||.||..|:||..|||||:|||..:||..|||
Human   711 TTIILSDEDFMEVVLGKLDPQKAFFSGRLKARGNIMLSQKLQMILKDYAKL 761

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11151NP_001259531.1 SCP2 9..109 CDD:396566 48/102 (47%)
HSD17B4NP_001186220.1 hydroxyacyl-CoA-like_DH_SDR_c-like 61..279 CDD:187611
PLN02864 353..630 CDD:178455
hot_dog <400..468 CDD:294345
HDE_HSD 510..631 CDD:239532
SCP2 653..756 CDD:280250 48/103 (47%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 94 1.000 Domainoid score I7491
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2120
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.