DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11151 and Mfe2

DIOPT Version :9

Sequence 1:NP_001259531.1 Gene:CG11151 / 32335 FlyBaseID:FBgn0030519 Length:115 Species:Drosophila melanogaster
Sequence 2:NP_001285318.1 Gene:Mfe2 / 32582 FlyBaseID:FBgn0030731 Length:598 Species:Drosophila melanogaster


Alignment Length:102 Identity:27/102 - (26%)
Similarity:36/102 - (35%) Gaps:29/102 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 AVFQKIIDGLKENEAKAKAVNGVFLYKITKDGKVAKEWTLDCKNAKAYEGPAQGIKVDTTLTVAD 71
            |.:..:|||.|..|...||...|.:.               ..||        ||..|.:|....
  Fly    74 ADYNSVIDGAKVIETAIKAFGRVDIL---------------VNNA--------GILRDRSLVKTS 115

  Fly    72 ED----MVDIAL-GKLN-PQAAFMKGKLKIAGNIMLT 102
            |.    :.|:.| |... .||||...|.:..|.|::|
  Fly   116 EQDWNLVNDVHLKGSFKCTQAAFPYMKKQNYGRIIMT 152

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11151NP_001259531.1 SCP2 9..109 CDD:396566 26/100 (26%)
Mfe2NP_001285318.1 hydroxyacyl-CoA-like_DH_SDR_c-like 8..257 CDD:187611 27/102 (26%)
PRK07791 11..248 CDD:236099 27/102 (26%)
PLN02864 315..598 CDD:178455
hot_dog <383..442 CDD:294345
HDE_HSD 471..592 CDD:239532
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2120
SonicParanoid 00.000 Not matched by this tool.
11.030

Return to query results.
Submit another query.