DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11151 and hsdl2

DIOPT Version :9

Sequence 1:NP_001259531.1 Gene:CG11151 / 32335 FlyBaseID:FBgn0030519 Length:115 Species:Drosophila melanogaster
Sequence 2:NP_955893.1 Gene:hsdl2 / 322347 ZFINID:ZDB-GENE-030131-1066 Length:415 Species:Danio rerio


Alignment Length:87 Identity:33/87 - (37%)
Similarity:44/87 - (50%) Gaps:3/87 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 KAVNGVFLYKITKDGKVAKEWTLDCKNAKAYEGPAQ-GIKVDTTLTVADEDMVDIALGKLNPQAA 87
            |...||  ||....|:.|..|.||.||.....|..: .:|.|..:::..||.|.:..|||.|..|
Zfish   324 KTTQGV--YKFNLAGEHAGVWYLDLKNDAGSAGNGEPPVKADVVMSMDSEDFVKMFGGKLKPTMA 386

  Fly    88 FMKGKLKIAGNIMLTQKLAPLL 109
            ||.|||.|.|::.|..||..::
Zfish   387 FMSGKLTIKGDMGLAIKLEKMM 408

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11151NP_001259531.1 SCP2 9..109 CDD:396566 33/85 (39%)
hsdl2NP_955893.1 HSDL2_SDR_c 8..248 CDD:187663
adh_short 12..210 CDD:278532
SCP2 311..408 CDD:280250 33/85 (39%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4170
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.