DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11151 and Scp2d1

DIOPT Version :9

Sequence 1:NP_001259531.1 Gene:CG11151 / 32335 FlyBaseID:FBgn0030519 Length:115 Species:Drosophila melanogaster
Sequence 2:NP_001101255.1 Gene:Scp2d1 / 311491 RGDID:1308385 Length:156 Species:Rattus norvegicus


Alignment Length:114 Identity:46/114 - (40%)
Similarity:67/114 - (58%) Gaps:4/114 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 QSDAVFQKIIDGLKENEAK-AKAVNGVFLYKITKDGKVAKEWTLDCKNAKA--YEGPAQGIKVDT 65
            ||.:||:.|...:||..|: .|.||.:|...||||||...:||:|.||...  |.|.|: :..||
  Rat    43 QSFSVFEDISHHIKEGGAQLVKKVNAIFQLDITKDGKTILQWTIDLKNGSGDMYLGSAR-LPADT 106

  Fly    66 TLTVADEDMVDIALGKLNPQAAFMKGKLKIAGNIMLTQKLAPLLKTDAK 114
            ...:.|....::.:||:|||.||:.||.|:.|.::|:|||..:.:..||
  Rat   107 IFIIPDTVFTELVVGKMNPQKAFLAGKFKVRGKVLLSQKLERIFREWAK 155

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11151NP_001259531.1 SCP2 9..109 CDD:396566 41/102 (40%)
Scp2d1NP_001101255.1 SCP2 60..151 CDD:280250 37/91 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 102 1.000 Domainoid score I6689
eggNOG 1 0.900 - - E1_KOG4170
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 84 1.000 Inparanoid score I5086
OMA 1 1.010 - - QHG57782
OrthoDB 1 1.010 - - D1490913at2759
OrthoFinder 1 1.000 - - FOG0006583
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X11696
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1110.840

Return to query results.
Submit another query.