DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11151 and Stoml1

DIOPT Version :9

Sequence 1:NP_001259531.1 Gene:CG11151 / 32335 FlyBaseID:FBgn0030519 Length:115 Species:Drosophila melanogaster
Sequence 2:NP_001292167.1 Gene:Stoml1 / 300748 RGDID:1559463 Length:398 Species:Rattus norvegicus


Alignment Length:109 Identity:25/109 - (22%)
Similarity:47/109 - (43%) Gaps:9/109 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 QKIIDGLKE------NEAKAKAVNGVFLYKITKDGKVAKEWTLDCK--NAKAYEGPAQGIKVDTT 66
            |.:.:||..      :|:....|...:.:.:.........:.||..  ..:...|...||. |..
  Rat   288 QPVAEGLLTALQPFLSESLVSQVGACYQFNVLLPSGTQSIYFLDLTTGQGRVGHGVPDGIP-DVV 351

  Fly    67 LTVADEDMVDIALGKLNPQAAFMKGKLKIAGNIMLTQKLAPLLK 110
            :.:|:.|:..:...:|.|..|:|.|:||:.|::.:..||..:||
  Rat   352 VEMAEADLQALLCKELRPLGAYMSGRLKVKGDLAVVMKLEAVLK 395

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11151NP_001259531.1 SCP2 9..109 CDD:396566 23/106 (22%)
Stoml1NP_001292167.1 PHB 77..217 CDD:214581
SPFH_SLP-1 94..224 CDD:259814
SCP2 304..395 CDD:280250 20/91 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4170
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.