DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11151 and Scp2

DIOPT Version :9

Sequence 1:NP_001259531.1 Gene:CG11151 / 32335 FlyBaseID:FBgn0030519 Length:115 Species:Drosophila melanogaster
Sequence 2:NP_612517.3 Gene:Scp2 / 25541 RGDID:3642 Length:547 Species:Rattus norvegicus


Alignment Length:117 Identity:51/117 - (43%)
Similarity:73/117 - (62%) Gaps:6/117 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 QSDAVFQKIIDGL-KENEAKAKAVNGVFLYKITKDGKVAKE--WTLDCKNAKAYEGPAQGIKVDT 65
            :::.:|::|...| :|.|...|.:.|:|.:|: |||...||  |.:|.||.|....|....|.|.
  Rat   432 KANLIFKEIEKKLEEEGEEFVKKIGGIFAFKV-KDGPGGKEATWVVDVKNGKGSVLPDSDKKADC 495

  Fly    66 TLTVADEDMVDIALGKLNPQAAFMKGKLKIAGNIMLTQKLAPL-LKTD-AKL 115
            |:|:||.|::.:..||:|||:||.:||||||||:.|..||..| |:.| |||
  Rat   496 TITMADSDLLALMTGKMNPQSAFFQGKLKIAGNMGLAMKLQSLQLQPDKAKL 547

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11151NP_001259531.1 SCP2 9..109 CDD:396566 46/103 (45%)
Scp2NP_612517.3 PRK08256 12..404 CDD:181327
SCP2 452..538 CDD:396566 40/86 (47%)
Microbody targeting signal. /evidence=ECO:0000255 545..547 1/1 (100%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4170
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.