DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11151 and dhs-28

DIOPT Version :9

Sequence 1:NP_001259531.1 Gene:CG11151 / 32335 FlyBaseID:FBgn0030519 Length:115 Species:Drosophila melanogaster
Sequence 2:NP_509146.1 Gene:dhs-28 / 180950 WormBaseID:WBGene00000991 Length:436 Species:Caenorhabditis elegans


Alignment Length:117 Identity:55/117 - (47%)
Similarity:75/117 - (64%) Gaps:5/117 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 SLQSDAVFQKIIDGLKENEAKAKAVNGVFLYKITKDGK-VAKEWTLDCKNA--KAYEGPAQ-GIK 62
            :::|.|:||::.||:|.:....|.:..:.||.|| ||| ...::|||.|:|  ..|.|..: |.|
 Worm   318 NIRSSALFQEMADGVKADPTAVKTLKSIVLYIIT-DGKNELGKFTLDFKSASPSVYLGDVKNGEK 381

  Fly    63 VDTTLTVADEDMVDIALGKLNPQAAFMKGKLKIAGNIMLTQKLAPLLKTDAK 114
            .:.|:||||.|.||||.||||.|.|||.||||:.||:||.|||..:|:...|
 Worm   382 ANATVTVADSDFVDIAAGKLNAQKAFMSGKLKVKGNVMLLQKLQTVLEKAKK 433

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11151NP_001259531.1 SCP2 9..109 CDD:396566 51/103 (50%)
dhs-28NP_509146.1 hydroxyacyl-CoA-like_DH_SDR_c-like 3..252 CDD:187611
SCP2 325..429 CDD:376720 51/104 (49%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 76 1.000 Domainoid score I5881
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2120
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.940

Return to query results.
Submit another query.