DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11151 and dhs-28

DIOPT Version :10

Sequence 1:NP_572917.1 Gene:CG11151 / 32335 FlyBaseID:FBgn0030519 Length:115 Species:Drosophila melanogaster
Sequence 2:NP_509146.1 Gene:dhs-28 / 180950 WormBaseID:WBGene00000991 Length:436 Species:Caenorhabditis elegans


Alignment Length:117 Identity:55/117 - (47%)
Similarity:75/117 - (64%) Gaps:5/117 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 SLQSDAVFQKIIDGLKENEAKAKAVNGVFLYKITKDGK-VAKEWTLDCKNA--KAYEGPAQ-GIK 62
            :::|.|:||::.||:|.:....|.:..:.||.|| ||| ...::|||.|:|  ..|.|..: |.|
 Worm   318 NIRSSALFQEMADGVKADPTAVKTLKSIVLYIIT-DGKNELGKFTLDFKSASPSVYLGDVKNGEK 381

  Fly    63 VDTTLTVADEDMVDIALGKLNPQAAFMKGKLKIAGNIMLTQKLAPLLKTDAK 114
            .:.|:||||.|.||||.||||.|.|||.||||:.||:||.|||..:|:...|
 Worm   382 ANATVTVADSDFVDIAAGKLNAQKAFMSGKLKVKGNVMLLQKLQTVLEKAKK 433

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11151NP_572917.1 SCP2 9..110 CDD:460423 51/104 (49%)
dhs-28NP_509146.1 hydroxyacyl-CoA-like_DH_SDR_c-like 3..252 CDD:187611
SCP2 325..429 CDD:460423 51/104 (49%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.