DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11151 and dhrs-4

DIOPT Version :9

Sequence 1:NP_001259531.1 Gene:CG11151 / 32335 FlyBaseID:FBgn0030519 Length:115 Species:Drosophila melanogaster
Sequence 2:NP_506230.1 Gene:dhrs-4 / 179772 WormBaseID:WBGene00010063 Length:260 Species:Caenorhabditis elegans


Alignment Length:104 Identity:25/104 - (24%)
Similarity:41/104 - (39%) Gaps:28/104 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 KAVNGVFLYKITKDGKVAKEWTLDCKNAK---AYEGPAQGI---KVDTTLTVADE-------DMV 75
            |:..|:..|.:||...|.....|....||   ...|.|.|:   |:...|....|       |:.
 Worm   153 KSPPGIAAYGVTKTTLVGLTRALAMGLAKDNIRVNGIAPGVIKTKMSQVLWDGGEDAEKELTDIQ 217

  Fly    76 DIALGKL--------------NPQAAFMKGK-LKIAGNI 99
            :||||:|              :..::::.|: :.|||.:
 Worm   218 EIALGRLGVPDDCAGTVAYLASDDSSYITGEMIIIAGGV 256

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11151NP_001259531.1 SCP2 9..109 CDD:396566 25/104 (24%)
dhrs-4NP_506230.1 SDR 9..260 CDD:330230 25/104 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2120
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.030

Return to query results.
Submit another query.