DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11151 and SCP2D1

DIOPT Version :9

Sequence 1:NP_001259531.1 Gene:CG11151 / 32335 FlyBaseID:FBgn0030519 Length:115 Species:Drosophila melanogaster
Sequence 2:NP_848578.1 Gene:SCP2D1 / 140856 HGNCID:16211 Length:156 Species:Homo sapiens


Alignment Length:114 Identity:47/114 - (41%)
Similarity:68/114 - (59%) Gaps:4/114 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 QSDAVFQKIIDGLKENEAK-AKAVNGVFLYKITKDGKVAKEWTLDCKNAKA--YEGPAQGIKVDT 65
            :|..|||.|...::|..|: .|.||.||...|||:||....||:|.||...  |.|||: :..||
Human    43 ESFPVFQDIRLHIREVGAQLVKKVNAVFQLDITKNGKTILRWTIDLKNGSGDMYPGPAR-LPADT 106

  Fly    66 TLTVADEDMVDIALGKLNPQAAFMKGKLKIAGNIMLTQKLAPLLKTDAK 114
            ..|:.:...:::.|||:|||.||:.||.|::|.::|:.||..:.|..||
Human   107 VFTIPESVFMELVLGKMNPQKAFLAGKFKVSGKVLLSWKLERVFKDWAK 155

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11151NP_001259531.1 SCP2 9..109 CDD:396566 42/102 (41%)
SCP2D1NP_848578.1 SCP2 60..151 CDD:307934 38/91 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 94 1.000 Domainoid score I7491
eggNOG 1 0.900 - - E1_KOG4170
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 82 1.000 Inparanoid score I5211
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG57782
OrthoDB 1 1.010 - - D1490913at2759
OrthoFinder 1 1.000 - - FOG0006583
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11696
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
109.840

Return to query results.
Submit another query.