DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11134 and add3a

DIOPT Version :9

Sequence 1:NP_001259530.1 Gene:CG11134 / 32334 FlyBaseID:FBgn0030518 Length:227 Species:Drosophila melanogaster
Sequence 2:XP_017208635.1 Gene:add3a / 556762 ZFINID:ZDB-GENE-030131-2721 Length:678 Species:Danio rerio


Alignment Length:204 Identity:39/204 - (19%)
Similarity:70/204 - (34%) Gaps:45/204 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    41 KYNDEIYIAPSGVQKERMQPEDLFVQDITGKDLQLPPEIKGLKKSQCTPLFMLAYQHRQAGAVIH 105
            |..|.|.|.|.|:........:|...:|.|..:........:..:..:|...:.........::|
Zfish   167 KEQDHILIIPRGLSFAEASASNLVKVNILGDVIDQGSTNLRIDAAGFSPHAAIYSIRPDVRCIVH 231

  Fly   106 THSQHAVMATLLWPGKTFRCTHLEMIKGVYDEADKRYLRY----DEELVVPIIENTPFERDLADS 166
            . |..|..|.     .:.:|..|.:.:......|..|..|    ||:     .|....::.|.  
Zfish   232 I-STPATAAV-----SSMKCGLLPISQEALILGDIAYYNYQGSLDEQ-----EERVELQKALG-- 283

  Fly   167 MYAAMMEYPGCSAILVRRHGVYVWGQNWEKAKTMSECYDYLF--SIAVEMKK-----AG------ 218
                    |....:::|.||:...|:      |:.|.:.|::  ..|.|::.     ||      
Zfish   284 --------PTAKVLVLRNHGIVALGE------TIEEAFHYIYGAQYACEIQVNAFSCAGGMENLI 334

  Fly   219 -IDPEKFES 226
             :|.|||::
Zfish   335 VLDLEKFKA 343

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11134NP_001259530.1 salvage_mtnB 18..216 CDD:274521 33/180 (18%)
add3aXP_017208635.1 Aldolase_II 134..382 CDD:320825 39/204 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0235
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.