DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11134 and apip

DIOPT Version :9

Sequence 1:NP_001259530.1 Gene:CG11134 / 32334 FlyBaseID:FBgn0030518 Length:227 Species:Drosophila melanogaster
Sequence 2:NP_001015712.1 Gene:apip / 548429 XenbaseID:XB-GENE-978323 Length:239 Species:Xenopus tropicalis


Alignment Length:209 Identity:146/209 - (69%)
Similarity:166/209 - (79%) Gaps:0/209 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 HPRHLIPSLCRQFYHLGWVTGTGGGMSIKYNDEIYIAPSGVQKERMQPEDLFVQDITGKDLQLPP 77
            |||:|||.||||||:||||||||||:|:||.||||||||||||||:||:||||.||..||:..||
 Frog    20 HPRNLIPELCRQFYNLGWVTGTGGGISLKYGDEIYIAPSGVQKERIQPDDLFVCDIDEKDISSPP 84

  Fly    78 EIKGLKKSQCTPLFMLAYQHRQAGAVIHTHSQHAVMATLLWPGKTFRCTHLEMIKGVYDEADKRY 142
            ..:.|||||||||||.||..|.|||||||||:.||||||::|||.|..||.|||||:.......|
 Frog    85 PYRNLKKSQCTPLFMNAYTMRDAGAVIHTHSKAAVMATLMFPGKEFLITHQEMIKGIKKGTSGGY 149

  Fly   143 LRYDEELVVPIIENTPFERDLADSMYAAMMEYPGCSAILVRRHGVYVWGQNWEKAKTMSECYDYL 207
            .|||:.|.|||:||||.|:||.:.|..||.|||...|:|||||||||||..|||||||.||||||
 Frog   150 YRYDDMLAVPIVENTPEEKDLKERMARAMTEYPDTCAVLVRRHGVYVWGDTWEKAKTMCECYDYL 214

  Fly   208 FSIAVEMKKAGIDP 221
            |.|||:||:.|:||
 Frog   215 FEIAVQMKQHGLDP 228

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11134NP_001259530.1 salvage_mtnB 18..216 CDD:274521 138/197 (70%)
apipNP_001015712.1 salvage_mtnB 25..223 CDD:274521 138/197 (70%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 284 1.000 Domainoid score I1615
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H6277
Inparanoid 1 1.050 308 1.000 Inparanoid score I2584
OMA 1 1.010 - - QHG53909
OrthoDB 1 1.010 - - D1062330at2759
OrthoFinder 1 1.000 - - FOG0004473
OrthoInspector 1 1.000 - - oto103744
Panther 1 1.100 - - LDO PTHR10640
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R759
SonicParanoid 1 1.000 - - X4255
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
1212.110

Return to query results.
Submit another query.