DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11134 and add1

DIOPT Version :9

Sequence 1:NP_001259530.1 Gene:CG11134 / 32334 FlyBaseID:FBgn0030518 Length:227 Species:Drosophila melanogaster
Sequence 2:XP_017947468.1 Gene:add1 / 448173 XenbaseID:XB-GENE-995030 Length:913 Species:Xenopus tropicalis


Alignment Length:228 Identity:46/228 - (20%)
Similarity:81/228 - (35%) Gaps:52/228 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 FYHL----GWVTGTGGGMSIKYNDE---IYIAPSGVQKERMQPEDLFVQDITGKDLQLPPEIKGL 82
            |:.|    ||.......::::.|.|   ..|.|.|:....:....|...::.|:.:.......|:
 Frog   152 FHRLADLFGWSQLIYNHITVRVNSEQEHFLIVPFGLLYSEVTASSLIKVNLQGELVDRGSTNLGV 216

  Fly    83 KKSQCTPLFMLAYQHR-QAGAVIHTHSQHAVMATLLWPGKTFRCTHLEMIKGVYDEADKRYLRY- 145
            .|:..| |....|..| ....::|.||......:.:      :|..|.:........:..|..| 
 Frog   217 NKAGFT-LHSAIYAARPDVKCIVHIHSPAGAAVSAM------KCGLLPLSPEALSLGEVAYHDYH 274

  Fly   146 ----DEELVVPIIENTPFERDLADSMYAAMMEYPGCSAILVRRHGVYVWGQNWEKA-----KTMS 201
                |||      |....:::|.          |....:::|.||:...|:..|:|     ..||
 Frog   275 GILVDEE------EKVLIQKNLG----------PKSKVLILRNHGLVTMGETVEEAFYYIHNLMS 323

  Fly   202 ECYDYLFSIAVEMKKAG-------IDPEKFESS 227
            .|...:.::|    .||       :||.|::.|
 Frog   324 ACEIQVRTLA----SAGGPDNLVLLDPGKYKKS 352

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11134NP_001259530.1 salvage_mtnB 18..216 CDD:274521 40/208 (19%)
add1XP_017947468.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.