DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11134 and apip

DIOPT Version :9

Sequence 1:NP_001259530.1 Gene:CG11134 / 32334 FlyBaseID:FBgn0030518 Length:227 Species:Drosophila melanogaster
Sequence 2:NP_001004679.1 Gene:apip / 447941 ZFINID:ZDB-GENE-040912-128 Length:241 Species:Danio rerio


Alignment Length:213 Identity:144/213 - (67%)
Similarity:163/213 - (76%) Gaps:0/213 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 EHPRHLIPSLCRQFYHLGWVTGTGGGMSIKYNDEIYIAPSGVQKERMQPEDLFVQDITGKDLQLP 76
            |.||.|||.|||.||.||||||||||:|:::.:.||||||||||||:|||||||.||..||:..|
Zfish    21 EDPRVLIPQLCRLFYELGWVTGTGGGISLRHGEHIYIAPSGVQKERIQPEDLFVCDIDEKDISCP 85

  Fly    77 PEIKGLKKSQCTPLFMLAYQHRQAGAVIHTHSQHAVMATLLWPGKTFRCTHLEMIKGVYDEADKR 141
            |..|.||||||||.||.||..|.|.|||||||:.|||||||:|||.||.||.|||||:.......
Zfish    86 PPQKKLKKSQCTPPFMNAYTMRGAQAVIHTHSKSAVMATLLFPGKEFRITHQEMIKGIRKGNSGT 150

  Fly   142 YLRYDEELVVPIIENTPFERDLADSMYAAMMEYPGCSAILVRRHGVYVWGQNWEKAKTMSECYDY 206
            ..|||:.||||||||||.|:||.:.|..||..||...|:|||||||||||:.|||||||.|||||
Zfish   151 NFRYDDTLVVPIIENTPEEKDLKERMARAMDMYPDSCAVLVRRHGVYVWGETWEKAKTMCECYDY 215

  Fly   207 LFSIAVEMKKAGIDPEKF 224
            ||.|||:||::|:||..|
Zfish   216 LFDIAVQMKQSGLDPSAF 233

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11134NP_001259530.1 salvage_mtnB 18..216 CDD:274521 135/197 (69%)
apipNP_001004679.1 salvage_mtnB 27..225 CDD:274521 135/197 (69%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170587257
Domainoid 1 1.000 268 1.000 Domainoid score I1814
eggNOG 1 0.900 - - E1_COG0235
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H6277
Inparanoid 1 1.050 292 1.000 Inparanoid score I2765
OMA 1 1.010 - - QHG53909
OrthoDB 1 1.010 - - D1062330at2759
OrthoFinder 1 1.000 - - FOG0004473
OrthoInspector 1 1.000 - - oto40986
orthoMCL 1 0.900 - - OOG6_103116
Panther 1 1.100 - - LDO PTHR10640
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X4255
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
1514.770

Return to query results.
Submit another query.