DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11134 and Apip

DIOPT Version :9

Sequence 1:NP_001259530.1 Gene:CG11134 / 32334 FlyBaseID:FBgn0030518 Length:227 Species:Drosophila melanogaster
Sequence 2:NP_001099962.2 Gene:Apip / 295961 RGDID:1564562 Length:241 Species:Rattus norvegicus


Alignment Length:213 Identity:149/213 - (69%)
Similarity:170/213 - (79%) Gaps:0/213 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 EHPRHLIPSLCRQFYHLGWVTGTGGGMSIKYNDEIYIAPSGVQKERMQPEDLFVQDITGKDLQLP 76
            ||||.|||.||:||||||||||||||:|:|:.:|||||||||||||:||||:||.||..:|:..|
  Rat    21 EHPRFLIPELCKQFYHLGWVTGTGGGISLKHGNEIYIAPSGVQKERIQPEDMFVCDINEQDISGP 85

  Fly    77 PEIKGLKKSQCTPLFMLAYQHRQAGAVIHTHSQHAVMATLLWPGKTFRCTHLEMIKGVYDEADKR 141
            |..|.|||||||||||.||..|.|||||||||:.|||||||:||:.|:.||.|||||:.......
  Rat    86 PASKNLKKSQCTPLFMNAYTMRGAGAVIHTHSKAAVMATLLFPGQEFKITHQEMIKGIRKCTSGG 150

  Fly   142 YLRYDEELVVPIIENTPFERDLADSMYAAMMEYPGCSAILVRRHGVYVWGQNWEKAKTMSECYDY 206
            |.|||:.||||||||||.|:||.:.|..||.|||...|:|||||||||||:.|||||||.|||||
  Rat   151 YYRYDDILVVPIIENTPEEKDLKERMARAMNEYPDSCAVLVRRHGVYVWGETWEKAKTMCECYDY 215

  Fly   207 LFSIAVEMKKAGIDPEKF 224
            ||.|||.|||.|:||.:|
  Rat   216 LFDIAVSMKKMGLDPTQF 233

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11134NP_001259530.1 salvage_mtnB 18..216 CDD:274521 138/197 (70%)
ApipNP_001099962.2 salvage_mtnB 27..225 CDD:274521 138/197 (70%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166346280
Domainoid 1 1.000 282 1.000 Domainoid score I1595
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 311 1.000 Inparanoid score I2521
OMA 1 1.010 - - QHG53909
OrthoDB 1 1.010 - - D1062330at2759
OrthoFinder 1 1.000 - - FOG0004473
OrthoInspector 1 1.000 - - oto97050
orthoMCL 1 0.900 - - OOG6_103116
Panther 1 1.100 - - LDO PTHR10640
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X4255
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
1312.910

Return to query results.
Submit another query.