DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11134 and Add3

DIOPT Version :9

Sequence 1:NP_001259530.1 Gene:CG11134 / 32334 FlyBaseID:FBgn0030518 Length:227 Species:Drosophila melanogaster
Sequence 2:NP_001157571.1 Gene:Add3 / 27360 MGIID:1351615 Length:706 Species:Mus musculus


Alignment Length:239 Identity:49/239 - (20%)
Similarity:80/239 - (33%) Gaps:84/239 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 IPSLCRQFYHLGWVTGTGGGMSI---KYNDEIYIAPSGVQKERMQPEDLFVQDITGK-------D 72
            :.||.|.....||.......:|:   |..|.|.|.|.|:.........|...:|.|:       |
Mouse   141 LASLYRLADLFGWAHLANTYISVRISKEQDHIIIIPRGLSFSEATASTLVKVNIIGEVVDQGSTD 205

  Fly    73 LQLP--------------PEIKGLKKSQCTPLFMLAYQHRQAGAVIHTHSQHAVMATLLWPGKTF 123
            |::.              |::|                     .|||.|:    :||.  ...:.
Mouse   206 LKIDHTGFSPHAAIYSTRPDVK---------------------CVIHIHT----LATA--AVSSM 243

  Fly   124 RCTHLEMIKGVYDEADKRYLRY----DEELVVPIIENTPFERDLADSMYAAMMEYPGCSAILVRR 184
            :|..|.:.:......|..|..|    |||     .|....::.|.          |.|..:::|.
Mouse   244 KCGILPISQESLILGDVAYYDYQGSLDEE-----EERIELQKVLG----------PSCKVLVLRN 293

  Fly   185 HGVYVWGQNWEKAKTMSECYDYLFSI--AVEMK------KAGID 220
            ||:...|:      |:.|.:.|:|::  |.|::      ..|:|
Mouse   294 HGMVALGE------TLEEAFHYIFNVQMACEIQVQAVAGAGGVD 331

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11134NP_001259530.1 salvage_mtnB 18..216 CDD:274521 47/233 (20%)
Add3NP_001157571.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..23
Aldolase_II 137..385 CDD:381867 49/239 (21%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 471..495
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 534..556
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 574..610
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 651..706
Interaction with calmodulin. /evidence=ECO:0000255 684..701
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0235
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.