DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11134 and SPAC9.06c

DIOPT Version :9

Sequence 1:NP_001259530.1 Gene:CG11134 / 32334 FlyBaseID:FBgn0030518 Length:227 Species:Drosophila melanogaster
Sequence 2:NP_593349.2 Gene:SPAC9.06c / 2543665 PomBaseID:SPAC9.06c Length:200 Species:Schizosaccharomyces pombe


Alignment Length:221 Identity:69/221 - (31%)
Similarity:99/221 - (44%) Gaps:29/221 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MALSIFKDLPAEHPRHLIPSLCRQFYHLGWVTGTGGGMSIKYNDEIYIAPSGVQKERMQPEDLFV 65
            |:|.:.|:|..|    |||    .||.|||:....|...:|.|.........||::.:...|:..
pombe     1 MSLQLEKNLILE----LIP----HFYSLGWMKFGSGNFCLKNNGYAICVKDRVQRDFITENDIVT 57

  Fly    66 -----QDITGKDLQLPPEIKGLKKSQCTPLFMLAYQHRQAGAVIHTHSQHAVMATLLWPGKTFRC 125
                 |.:| |||           .....:|.....:..|.|.|::.|..||.|::.  .:.|..
pombe    58 FNLSNQSVT-KDL-----------VNWAYIFSWVLSNMDAVACIYSTSVAAVGASMY--NEKFTT 108

  Fly   126 THLEMIKGV-YDEADKRYLRYDEELVVPIIENTPFERDLADSMYAAMMEYPGCSAILVRRHGVYV 189
            ...|||||: .......||...:.|.||||.|.. .:.:.|.:...:..||...|:|:|.|||..
pombe   109 QSKEMIKGIPKGNPSAGYLCCFDTLEVPIIHNGD-SKTILDELKKVIELYPQTCAVLIRGHGVIG 172

  Fly   190 WGQNWEKAKTMSECYDYLFSIAVEMK 215
            ||..|||:||..|||:|||.:..::|
pombe   173 WGATWEKSKTQMECYEYLFELDYKLK 198

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11134NP_001259530.1 salvage_mtnB 18..216 CDD:274521 63/204 (31%)
SPAC9.06cNP_593349.2 AraD 1..200 CDD:223313 69/221 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0235
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0004473
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10640
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R759
SonicParanoid 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
65.900

Return to query results.
Submit another query.