DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11134 and Add1

DIOPT Version :9

Sequence 1:NP_001259530.1 Gene:CG11134 / 32334 FlyBaseID:FBgn0030518 Length:227 Species:Drosophila melanogaster
Sequence 2:XP_017454553.1 Gene:Add1 / 24170 RGDID:2041 Length:797 Species:Rattus norvegicus


Alignment Length:229 Identity:43/229 - (18%)
Similarity:80/229 - (34%) Gaps:56/229 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 FYHL----GWVTGTGGGMSIKYNDE---IYIAPSGVQKERMQPEDLFVQDITGKDLQLPPEIKGL 82
            ||.|    ||.......::.:.|.|   ..|.|.|:....:....|...::.|..:.......|:
  Rat   152 FYRLADLFGWSQLIYNHITTRVNSEQEHFLIVPFGLLYSEVTASSLVKVNLQGDIVDRGSTNLGV 216

  Fly    83 KKSQCTPLFMLAYQHR-QAGAVIHTHSQHAVMATLLWPGKTFRCTHLEMIKGVYDEADKRYLRY- 145
            .::..| |....|..| .|..::|.|:......:.:      :|..|.:........:..|..| 
  Rat   217 NQAGFT-LHSAIYAARPDAKCIVHIHTPAGAAVSAM------KCGLLPISPEALSLGEVAYHDYH 274

  Fly   146 ----DEELVVPIIENTPFERDLADSMYAAMMEYPGCSAILVRRHGVYVWGQNWEKAKTMSECYDY 206
                |||      |....:::|.          |....:::|.||:...|::.|      |.:.|
  Rat   275 GILVDEE------EKILIQKNLG----------PKSKVLILRNHGLVSVGESVE------EAFFY 317

  Fly   207 LFSIAV-------EMKKAG-------IDPEKFES 226
            :.::.|       .:..||       :||.|:::
  Rat   318 IHNLVVACEIQVRTLASAGGPDNLVLLDPGKYKA 351

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11134NP_001259530.1 salvage_mtnB 18..216 CDD:274521 38/210 (18%)
Add1XP_017454553.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0235
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.