DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11134 and ADD1

DIOPT Version :10

Sequence 1:NP_572916.1 Gene:CG11134 / 32334 FlyBaseID:FBgn0030518 Length:227 Species:Drosophila melanogaster
Sequence 2:NP_001341690.1 Gene:ADD1 / 118 HGNCID:243 Length:799 Species:Homo sapiens


Alignment Length:229 Identity:43/229 - (18%)
Similarity:80/229 - (34%) Gaps:56/229 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 FYHL----GWVTGTGGGMSIKYNDE---IYIAPSGVQKERMQPEDLFVQDITGKDLQLPPEIKGL 82
            ||.|    ||.......::.:.|.|   ..|.|.|:....:....|...::.|..:.......|:
Human   152 FYRLADLFGWSQLIYNHITTRVNSEQEHFLIVPFGLLYSEVTASSLVKINLQGDIVDRGSTNLGV 216

  Fly    83 KKSQCTPLFMLAYQHR-QAGAVIHTHSQHAVMATLLWPGKTFRCTHLEMIKGVYDEADKRYLRY- 145
            .::..| |....|..| ....|:|.|:......:.:      :|..|.:........:..|..| 
Human   217 NQAGFT-LHSAIYAARPDVKCVVHIHTPAGAAVSAM------KCGLLPISPEALSLGEVAYHDYH 274

  Fly   146 ----DEELVVPIIENTPFERDLADSMYAAMMEYPGCSAILVRRHGVYVWGQNWEKAKTMSECYDY 206
                |||      |....:::|.          |....:::|.||:...|::.|      |.:.|
Human   275 GILVDEE------EKVLIQKNLG----------PKSKVLILRNHGLVSVGESVE------EAFYY 317

  Fly   207 LFSIAV-------EMKKAG-------IDPEKFES 226
            :.::.|       .:..||       ::|||:::
Human   318 IHNLVVACEIQVRTLASAGGPDNLVLLNPEKYKA 351

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11134NP_572916.1 salvage_mtnB 18..216 CDD:274521 38/210 (18%)
ADD1NP_001341690.1 Aldolase_II 145..391 CDD:469663 43/229 (19%)
PHA03307 647..>770 CDD:223039
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.