Sequence 1: | NP_001259530.1 | Gene: | CG11134 / 32334 | FlyBaseID: | FBgn0030518 | Length: | 227 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001318011.1 | Gene: | Add1 / 11518 | MGIID: | 87918 | Length: | 795 | Species: | Mus musculus |
Alignment Length: | 229 | Identity: | 44/229 - (19%) |
---|---|---|---|
Similarity: | 80/229 - (34%) | Gaps: | 56/229 - (24%) |
- Green bases have known domain annotations that are detailed below.
Fly 25 FYHL----GWVTGTGGGMSIKYNDE---IYIAPSGVQKERMQPEDLFVQDITGKDLQLPPEIKGL 82
Fly 83 KKSQCTPLFMLAYQHR-QAGAVIHTHSQHAVMATLLWPGKTFRCTHLEMIKGVYDEADKRYLRY- 145
Fly 146 ----DEELVVPIIENTPFERDLADSMYAAMMEYPGCSAILVRRHGVYVWGQNWEKAKTMSECYDY 206
Fly 207 LFSIAV-------EMKKAG-------IDPEKFES 226 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG11134 | NP_001259530.1 | salvage_mtnB | 18..216 | CDD:274521 | 39/210 (19%) |
Add1 | NP_001318011.1 | Aldolase_II | 145..391 | CDD:381867 | 44/229 (19%) |
PHA03307 | 645..>766 | CDD:223039 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_COG0235 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.810 |