DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9941 and LUL3

DIOPT Version :9

Sequence 1:NP_572915.1 Gene:CG9941 / 32330 FlyBaseID:FBgn0030514 Length:789 Species:Drosophila melanogaster
Sequence 2:NP_197409.1 Gene:LUL3 / 832027 AraportID:AT5G19080 Length:378 Species:Arabidopsis thaliana


Alignment Length:411 Identity:106/411 - (25%)
Similarity:160/411 - (38%) Gaps:118/411 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 PSTNNAYKY--------PPRMGNFFGTHFIMGGERFDTPQPE--------------SYL-FGENA 58
            |..|..|.|        ||:.|..:..::.:...:...|.|.              ||. :|:|.
plant    19 PHHNPPYYYSDPPPQQPPPQNGYSYSHNYPVSTPQLSLPPPPAQPPSSSQPPPSQISYRPYGQNY 83

  Fly    59 DLN--------------------------FLGNRPTAFPYPP-PQANEPT-KTLKSLVNIRKESV 95
            ..|                          :.|..|.|...|| |.....| |.:|:.||:.|.:|
plant    84 HQNQYYPQQAPPYFTGYHHNGFNPMMRPVYFGPTPVAVMEPPAPYVEHQTAKKVKNDVNVNKATV 148

  Fly    96 RFVKTMNDKKLGGVLEKPKMKEIDRDLDLDKEKSNVTIEDVDGNVLCSMGLGGGDADMTPPPPPC 160
            |.|                                  .:|::                     |.
plant   149 RLV----------------------------------ADDLN---------------------PG 158

  Fly   161 SYNIEFTFDSDAKCAITIYYFCSEDVSPSGVTLVPR--EGLTSETYHYEKGINQCFSQ-PSHVFN 222
            .|.:.|.||:....:.||.:|..|:   |..|:||.  |........::||..|.|.| |....:
plant   159 HYLVSFVFDALFDGSFTIIFFGEEE---SKCTIVPHLPEAFPPIKVPFQKGAGQKFLQAPGTGID 220

  Fly   223 PQQMPEDELGYSPGREQYPVAI--HCVVEEGS---DECRQSHTTICVIDHHPENGSYVLRALKQK 282
            ......|:|......|.||:.|  ..|:...|   :.......|..|:: ...:||:.::.:||.
plant   221 LGFFSLDDLSKPSPEEVYPLVISAETVISPSSVSEEPLVHKQITQAVLE-KTNDGSFKVKVMKQI 284

  Fly   283 IFVDGLCYLLQEIYGIENKAVNKTSLDEEIDDHGSECVICMSETRDTLILPCRHLCLCNSCADSL 347
            ::::|..|.|||:|||:|.....|:.....|..|.|||||::|.:||.::||||||||:.||:.|
plant   285 LWIEGERYELQELYGIDNSITQGTAASGLEDTGGKECVICLTEPKDTAVMPCRHLCLCSDCAEEL 349

  Fly   348 RYQANNCPICRAPFRALLQIR 368
            |:|.|.|||||.|...|::|:
plant   350 RFQTNKCPICRQPIHELVKIK 370

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9941NP_572915.1 zf-C3HC4_3 318..360 CDD:290631 27/41 (66%)
LUL3NP_197409.1 COG5540 <267..363 CDD:227827 44/96 (46%)
mRING-HC-C3HC5_MGRN1_like---blasttree 320..360 CDD:319703 25/39 (64%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 77 1.000 Domainoid score I3082
eggNOG 1 0.900 - - E1_KOG4265
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D883624at2759
OrthoFinder 1 1.000 - - FOG0001616
OrthoInspector 1 1.000 - - otm2664
orthoMCL 1 0.900 - - OOG6_102038
Panther 1 1.100 - - O PTHR22996
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X1025
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
109.820

Return to query results.
Submit another query.