DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9941 and LOG2

DIOPT Version :9

Sequence 1:NP_572915.1 Gene:CG9941 / 32330 FlyBaseID:FBgn0030514 Length:789 Species:Drosophila melanogaster
Sequence 2:NP_566356.1 Gene:LOG2 / 820135 AraportID:AT3G09770 Length:388 Species:Arabidopsis thaliana


Alignment Length:393 Identity:106/393 - (26%)
Similarity:156/393 - (39%) Gaps:122/393 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 DPSTNNAYKYP------PRMGNF----FGTHFIMGGERFDTPQP---ESYLFGENADLNFLGNRP 67
            :|:.|..|:||      |..|..    :..|.     :...|.|   .|:             .|
plant    58 NPNPNPVYQYPASYYHHPPPGAMPLPPYDHHL-----QHHPPHPYHNHSW-------------AP 104

  Fly    68 TA---FPYPPPQANEPTK--------TLKSLVNIRKESVRFVKTMNDKKLGGVLEKPKMKEIDRD 121
            .|   :||......:||.        |:::.||::|||:|                         
plant   105 VAMARYPYAGHMMAQPTPYVEHQKAVTIRNDVNLKKESLR------------------------- 144

  Fly   122 LDLDKEKSNVTIEDVDGNVLCSMGLGGGDADMTPPPPPCSYNIEFTFDSDAKCAITIYYFC--SE 184
            |:.|                              |..|..:.:.||||:.....|::.:|.  ||
plant   145 LEPD------------------------------PDNPGRFLVSFTFDATVSGRISVIFFAKESE 179

  Fly   185 DVSPSGVTLVPREGLTSETYHYEKGINQCFSQPS------HVFNPQQMPEDELGYSPGREQYPVA 243
            |..   :|....:.|...|..:|||:.|.|.|.|      .||...::    ...:...|.||:|
plant   180 DCK---LTATKEDILPPITLDFEKGLGQKFKQSSGSGIDFSVFEDVEL----FKAAADTEIYPLA 237

  Fly   244 IHCVV--------EEGSDECRQSHTTICVIDHHPENGSYVLRALKQKIFVDGLCYLLQEIYGIEN 300
            :....        ||.....:.:..|..|  :..:.|...:|.:||.::|:|..|.|||||||.|
plant   238 VKAEAAPSGGENEEEERSGSKNAQITQAV--YEKDKGEIKIRVVKQILWVNGTRYELQEIYGIGN 300

  Fly   301 KAVNKTSLDEEIDDHGSECVICMSETRDTLILPCRHLCLCNSCADSLRYQANNCPICRAPFRALL 365
            .........::.:|.|.|||||:||.|||.:|||||:|:|:.||..||:|.|.|||||.|...||
plant   301 TVEGDDDSADDANDPGKECVICLSEPRDTTVLPCRHMCMCSGCAKVLRFQTNRCPICRQPVERLL 365

  Fly   366 QIR 368
            :|:
plant   366 EIK 368

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9941NP_572915.1 zf-C3HC4_3 318..360 CDD:290631 28/41 (68%)
LOG2NP_566356.1 mRING-HC-C3HC5_MGRN1_like---blasttree 318..358 CDD:319703 26/39 (67%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 77 1.000 Domainoid score I3082
eggNOG 1 0.900 - - E1_KOG4265
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D883624at2759
OrthoFinder 1 1.000 - - FOG0001616
OrthoInspector 1 1.000 - - otm2664
orthoMCL 1 0.900 - - OOG6_102038
Panther 1 1.100 - - LDO PTHR22996
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X1025
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
98.820

Return to query results.
Submit another query.