DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9941 and cgrrf1

DIOPT Version :9

Sequence 1:NP_572915.1 Gene:CG9941 / 32330 FlyBaseID:FBgn0030514 Length:789 Species:Drosophila melanogaster
Sequence 2:NP_001038722.1 Gene:cgrrf1 / 692284 ZFINID:ZDB-GENE-040724-100 Length:337 Species:Danio rerio


Alignment Length:238 Identity:59/238 - (24%)
Similarity:100/238 - (42%) Gaps:70/238 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   174 CAITIYYFCSEDVSPSGVTLVPREGLTSE----TYH----YEKGINQCFSQPSHVFNPQ------ 224
            |.::.::.|       ||..: :..|.|.    .:|    :::.:..| .:....||.|      
Zfish    93 CVLSCFWGC-------GVQAL-QTALQSHQLELRFHTAELFQEALGSC-CRHHQTFNVQKEEREE 148

  Fly   225 ---QMPE----DELGYSPGREQYPVAIHCVVEEGSDECRQSH---TTICVIDHHPENGSYVL--R 277
               |||.    .:.|..| |::||:.  .|:.....|.|.::   :::.|| |.|:: .|.|  |
Zfish   149 YFTQMPPALEVTDFGLLP-RDRYPLV--AVLTLAHPETRDNYNIASSVTVI-HVPDD-KYRLSTR 208

  Fly   278 ALKQKIF-VDGLCYLLQEIY------------------GIENKAVNKTSLDEEIDDHGS------ 317
            .|.|.:. ..|..|.|:.::                  |.|.:..:.....||.|..|.      
Zfish   209 ILFQYLLTAHGTLYDLKPLFMSADNSNLSGSSEPSRTQGAELQPESSGEKGEESDSEGEWPDIQG 273

  Fly   318 -ECVICMSETRDTLILPCRHLCLCNSCADSLRYQANNCPICRA 359
             :||:|.:.:.:.::|||||.|:|:.|.  .|:|  :||||||
Zfish   274 RDCVVCQNASINRVLLPCRHACVCDGCV--CRFQ--HCPICRA 312

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9941NP_572915.1 zf-C3HC4_3 318..360 CDD:290631 19/42 (45%)
cgrrf1NP_001038722.1 zf-C3HC4_3 276..314 CDD:290631 19/41 (46%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4265
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.