DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9941 and Rnf26

DIOPT Version :9

Sequence 1:NP_572915.1 Gene:CG9941 / 32330 FlyBaseID:FBgn0030514 Length:789 Species:Drosophila melanogaster
Sequence 2:NP_717095.2 Gene:Rnf26 / 213211 MGIID:2388131 Length:424 Species:Mus musculus


Alignment Length:163 Identity:43/163 - (26%)
Similarity:62/163 - (38%) Gaps:71/163 - (43%)


- Green bases have known domain annotations that are detailed below.


  Fly   217 PSHVFN----PQQMP----EDELGYSP--GREQYPVAIHCVVEEGSDECRQSHTTICVIDHHPEN 271
            |..||:    ||..|    |:.:..:|  ||||.          ..||              |..
Mouse   314 PRRVFSARIQPQDTPPEAEEEVIRTAPARGREQL----------NEDE--------------PAA 354

  Fly   272 GSYVLRALKQKIFVDGLCYLLQEIYGIENKAVNKTSLDEEIDDHGSECVICMSETRDTLILPCRH 336
            |....:.||::                               :...:||||..:::..|:|||||
Mouse   355 GQDPWKLLKEQ-------------------------------EERKKCVICQDQSKTVLLLPCRH 388

  Fly   337 LCLCNSCADSL-RYQA--NNCPICRAPFRALLQ 366
            ||||.:|.:.| |:..  .|||:||   |::||
Mouse   389 LCLCQACTEILMRHPVYHRNCPLCR---RSILQ 418

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9941NP_572915.1 zf-C3HC4_3 318..360 CDD:290631 22/44 (50%)
Rnf26NP_717095.2 zf-C3HC4_3 367..419 CDD:290631 25/55 (45%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4265
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.