DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9941 and Cgrrf1

DIOPT Version :9

Sequence 1:NP_572915.1 Gene:CG9941 / 32330 FlyBaseID:FBgn0030514 Length:789 Species:Drosophila melanogaster
Sequence 2:XP_038948880.1 Gene:Cgrrf1 / 116679 RGDID:620803 Length:357 Species:Rattus norvegicus


Alignment Length:308 Identity:62/308 - (20%)
Similarity:116/308 - (37%) Gaps:92/308 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   112 KPKMKEIDRDLDLDKEKSN-------VTIED---VDGNVLCSMGLGGGDADMTPPPPPCSYNIEF 166
            |.:|:::.....|:...|:       ||:..   .|..:.|..|              ||  ::.
  Rat    58 KKQMRQVKNPFGLEITNSSAASLATGVTLTTDCLEDSRLTCYWG--------------CS--VQK 106

  Fly   167 TFDSDAKCAITIYYFCSEDVSPSGVTLVPREGLTSETYHYEK-GINQCFSQPSHVFNPQQMPEDE 230
            .::     |:..:.:|....:|..:    .|.|.|:..|.|: .|.:...:..:...|.....::
  Rat   107 LYE-----ALQKHVYCFRISTPQAL----EEALYSDYLHREQYFIKKHSKEEIYCQLPSSTGVED 162

  Fly   231 LGYSPGREQYP-VAIHCVVEEGSDE------------------------CRQSHTTICVIDHHPE 270
            .|..| |.:|| ||:..:.:|...|                        |.:...::..:.|.|:
  Rat   163 FGPVP-RSRYPLVALLTLADEDDREIYDIVQIYRKDPLHLVRTSQWFRVCTRPQISMVSVIHIPD 226

  Fly   271 NGSYVL--RALKQ-KIFVDGLCYLLQEIY------------------GIENKAVNKTSLD----E 310
            . :|.|  |.|.| .|...|..|.|::::                  .:|:..:.|..|.    :
  Rat   227 K-TYKLPCRILYQYLILAQGQFYDLKQLFMSANNSATPSRDQSPADGSVEHSLLEKAGLAGAEVD 290

  Fly   311 EIDDHGSECVICMSETRDTLILPCRHLCLCNSCADSLRYQANNCPICR 358
            .:::...:||:|.:...:.::|||||.|||:||....:    .||:||
  Rat   291 PVEESSKDCVVCQNGGVNWVLLPCRHACLCDSCVCYFK----QCPMCR 334

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9941NP_572915.1 zf-C3HC4_3 318..360 CDD:290631 17/41 (41%)
Cgrrf1XP_038948880.1 mRING-HC-C3HC5_CGRF1 298..334 CDD:319701 15/39 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4265
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.