DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment HOXD4 and btn

DIOPT Version :10

Sequence 1:NP_055436.2 Gene:HOXD4 / 3233 HGNCID:5138 Length:255 Species:Homo sapiens
Sequence 2:NP_732768.1 Gene:btn / 42664 FlyBaseID:FBgn0014949 Length:158 Species:Drosophila melanogaster


Alignment Length:106 Identity:40/106 - (37%)
Similarity:64/106 - (60%) Gaps:15/106 - (14%)


- Green bases have known domain annotations that are detailed below.


Human   120 QPPSGTALKQPAVVYPWMKKVHVNSVNPNYTGGEPKRSRTAYTRQQVLELEKEFHFNRYLTRRRR 184
            :.|:|..|..        ::..:.:::.|      ::.|||:::.|:.:||.||.::.||||.||
  Fly    66 EAPTGQELPS--------QRSKLRAISSN------RKERTAFSKTQLKQLEAEFCYSNYLTRLRR 116

Human   185 IEIAHTLCLSERQIKIWFQNRRMKWKKDHKLPNTKGRSSSS 225
            .|||..|.|:|||:|:||||||||.|: .||...:|.|:.:
  Fly   117 YEIAVALELTERQVKVWFQNRRMKCKR-IKLEEQQGSSAKT 156

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HOXD4NP_055436.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 31..127 2/6 (33%)
Antp-type hexapeptide 133..138 0/4 (0%)
Homeodomain 155..211 CDD:459649 31/55 (56%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 212..255 4/14 (29%)
btnNP_732768.1 Homeodomain 87..143 CDD:459649 31/55 (56%)

Return to query results.
Submit another query.